SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2pe5A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2pe5A
Domain Number 1 Region: 63-325
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.52e-75
Family L-arabinose binding protein-like 0.00000000209
Further Details:      
 
Domain Number 2 Region: 3-48
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 9.38e-25
Family GalR/LacI-like bacterial regulator 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2pe5A   PDB: 2pe5
Sequence length 330
Comment (A:)
Sequence
kpvtlydvaeyagvsyqtvsrvvnqashvsaktrekveaamaelnyipnrvaqqlagkql
lligvatsslalhapsqivaaiksradqlgasvvvsmversgveackaavhnllaqrvsg
liinyplddqdaiaveaactnvpalfldvsdqtpinsiifshedgtrlgvehlvalghqq
iallagplssvsarlrlagwhkyltrnqiqpiaeregdwsamsgfqqtmqmlnegivpta
mlvandqmalgamraitesglrvgadisvvgyddtedsscyipplttikqdfrllgqtsv
drllqlsqgqavkgnqllpvslvkrkttla
Download sequence
Identical sequences 2pe5_A 2pe5_B 2pe5_C 2pe5A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]