SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2ponB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2ponB
Domain Number 1 Region: 3-156
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 2.12e-72
Family Bcl-2 inhibitors of programmed cell death 0.000000555
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2ponB   PDB: 2pon
Sequence length 156
Comment (B:)
Sequence
msqsnrelvvdflsyklsqkgyswsqfsdveenrteapegteseavkqalreagdefelr
yrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgrivaffsfggalcvesvdkemq
vlvsriaawmatylndhlepwiqenggwdtfvelyg
Download sequence
Identical sequences 2pon_B 000051340|e1ysnA1|5000.3.1.2|A:5-160 000051348|e1ysiA1|5000.3.1.2|A:5-160 000051350|e1ysgA1|5000.3.1.2|A:5-160 000051352|e2ponB1|5000.3.1.2|B:1-156 000051355|e2o1yA1|5000.3.1.2|A:5-160 000051360|e1bxlA1|5000.3.1.2|A:5-48,A:89-200 000051361|e1g5jA1|5000.3.1.2|A:5-160 d2ponb_ 2ponB

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]