SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2psbA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2psbA
Domain Number 1 Region: 15-305
Classification Level Classification E-value
Superfamily YerB-like 3.51e-98
Family YerB-like 0.0000000000245
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2psbA   PDB: 2psb
Sequence length 320
Comment (A:)
Sequence
mqqkdavpdtakklkapltglkteqkvterrpvavvvnnhpkarpqsglskadivieala
egqitrflaifqsqmpetvgpvrsareyfvtlsngfdsifvhhgwspgakkqlesgaady
mngldfdgslfwradfskpphnsytsydyikkaaeqkgyklkqetnpllfqtsdakpane
synvrvdygtnnvtnlveynydkkaefytrssdgvittdretgkpvamqnifiveashhi
idqdgrrdidlesggkgllfqhgnvietdwkqvngrivpvkdgkwlpfvpgktwinivpd
ldaasiskgegvlehhhhhh
Download sequence
Identical sequences 2psbA 2psb_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]