SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2pubA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2pubA
Domain Number 1 Region: 58-331
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.78e-119
Family L-arabinose binding protein-like 0.00000000319
Further Details:      
 
Domain Number 2 Region: 2-46
Classification Level Classification E-value
Superfamily lambda repressor-like DNA-binding domains 2.73e-22
Family GalR/LacI-like bacterial regulator 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2pubA   PDB: 2pub
Sequence length 340
Comment (A:)
Sequence
atikdvakranvstttvshvinktrfvaeetrnavwaaikelhyspsavarslkvnhtks
igllatsseaayfaeiieavekncfqkgytlilgnawnnlekqraylsmmaqkrvdgllv
mcseypepllamleeyrhipmvvmdwgeakadftdavidnafeggymagrylierghrei
gvipgpleantgagrlagfmkameeamikvpeswivqgdfepesgyramqqilsqphrpt
avfcggdimamgalcaademglrvpqdvsligydnvrnaryftpalttihqpkdslgeta
fnmlldrivnkreepqsievhprlierrsvadgpfrdyrr
Download sequence
Identical sequences 2pubA 2pua_A 2pub_A 2puc_A 2pud_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]