SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2q3lA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2q3lA
Domain Number 1 Region: 2-125
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.49e-38
Family Sfri0576-like 0.000000229
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2q3lA   PDB: 2q3l
Sequence length 126
Comment (A:)
Sequence
gmssnlhgiaigiersqddfylafkavgklthedyeqmtpllesalagiktpeivalidi
teldglslhaawddlklglkhgkefkrvaiigqgelqewatrvanwftpgefkffedkrd
aldwlc
Download sequence
Identical sequences 2q3l_A 2q3l_B 2q3lA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]