SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2qalJ from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2qalJ
Domain Number 1 Region: 5-101
Classification Level Classification E-value
Superfamily Ribosomal protein S10 1.02e-35
Family Ribosomal protein S10 0.00000206
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2qalJ   PDB: 2qal
Sequence length 103
Comment (J:)
Sequence
MQNQRIRIRLKAFDHRLIDQATAEIVETAKRTGAQVRGPIPLPTRKERFTVLISPHVNKD
ARDQYEIRTHLRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG
Download sequence
Identical sequences A0A017I6F1 A0A023Z3I8 A0A024KR26 A0A025C3T6 A0A026V6Y3 A0A027T9T7 A0A027ZMP7 A0A028E9Y0 A0A029HGI2 A0A029IJU3 A0A062Y7Q0 A0A064T6Q7 A0A069XEJ0 A0A070FD04 A0A070SMP9 A0A070ULB7 A0A073G203 A0A073H3F1 A0A073UCQ3 A0A074HSV5 A0A077K4M2 A0A077K6P9 A0A077K6T4 A0A077K733 A0A077K758 A0A077K8B1 A0A077KC67 A0A077KDZ5 A0A080FNN4 A0A080IH15 A0A090NJM6 A0A0A0FHK4 A0A0A8UF47 A0A0E0U4Q4 A0A0E0VAX8 A0A0E0XTB8 A0A0E1M6N5 A0A0E1SZD7 A0A0E2KZJ0 A0A0E2TIC7 A0A0F6C9S7 A0A0F6FD30 A0A0F6MIE8 A0A0G3KCQ3 A0A0H3EQD3 A0A0H3Q1T5 A0A0I1VCM0 A0A0K9TDW4 A0A0M7PEY9 A0A0S3N293 A0A125WXK3 A0A127GQ94 A0A140N6Y5 A0A142H7H6 A0A163XSV7 A0A192CE42 A0A1E2VHN7 A0A1E3N2N9 A0A1Q8MKN9 A0A1Q8NFB1 A0A1S6TGI6 A0A1W2MGC6 A0A1X3I0T7 A0A1X3IFB2 A0A1X3IUK0 A0A1X3JB65 A0A1X3JPW8 A0A1X3K2W9 A0A1X3KEQ5 A0A1X3KX43 A0A1X3LCD7 A0A1X3LPK4 A0A1X3M653 A0A222QQZ8 A0A226KGL6 A0A2D0P231 A0A2H1BBV3 A0A2I6QJV7 A0A2I8C6H8 A1AGK8 A7ZSL0 A8A5C6 B1EQM2 B1IPX8 B1LHD5 B1X6H2 B2U2T9 B5YTP2 B6I235 B7L4L0 B7M1N5 B7MCT6 B7N1A5 B7NDU2 B7NLP0 B7UK45 C3SQT7 C4ZUH6 C8TXV1 C8UHG9 D2A911 D3GYV4 D3QTG0 D6I211 D6IEL9 D6JGA4 D7X302 D7XL08 D7Y3E1 D7Z9F4 D8A1N2 D8E8D6 E0J724 E1INR8 E1JB16 E2X8B5 E3PL05 E3XT31 E6BI69 E7SMZ1 E7SYX3 E7T8G5 E9TI34 E9XTI2 E9YV63 F3VBH6 F3WNL9 F4NN43 F4SQ48 F4T4K6 F4TL77 F4V731 F4VJW2 F5NAC6 F5P3A7 G0F4G3 H4IGZ9 H4IXY0 H4JDN5 H4KMT3 H4LI31 H4UQ25 I0VVM1 I2RDL9 I2RSF2 I2SV50 I2UH52 I2WEE2 I2X029 I2X6I5 I4T848 I6B887 I6C9W2 I6D1K0 I6DNH0 I6FJZ3 J7RLQ6 K0WPN2 K4WQS9 K4XS99 L2VHS1 L2VM56 L2XA25 L3C346 L3NU07 L3PZ93 L3QAA1 L4IYJ8 L4V303 M9GVR9 P0A7R5 P0A7R6 P0A7R7 P0A7R8 Q0SZY2 Q0TCE0 Q1R601 Q31VV5 Q32B30 Q3YWT8 R8XHA6 S0UAP5 S0VPW6 S0WVW0 S0XH20 S0YBG9 S1C9Q0 S1D5D0 S1EA65 S1GC73 S1GJ47 S1HTX4 S1JCS6 S1L5Z0 S1PLT3 T5U892 T5ZRR1 T6H887 T6LV85 T8KEI6 T9AXZ8 T9CJ79 T9SEW6 U9Y4L5 U9YIT3 U9YKN5 U9ZUL1 V0ANK5 V0SNN0 V0VLQ9 V0YEZ4 V0ZDE9 V2RU41 V2T4U3 V6FWV7 V8FDJ4 V8K2I8 W0AVV7 W0FQA7 W1BC66 W1WLC8 W8ZNU1
gi|117625599|ref|YP_858922.1| 2qalJ gi|386711214|ref|YP_006174935.1| gi|556553211|ref|YP_008723688.1| gi|218691607|ref|YP_002399819.1| gi|110643560|ref|YP_671290.1| gi|15833440|ref|NP_312213.1| NP_312213.1.58667 NP_417780.1.90541 NP_709109.1.23235 WP_001181004.1.1000 WP_001181004.1.10001 WP_001181004.1.100014 WP_001181004.1.100044 WP_001181004.1.100052 WP_001181004.1.100063 WP_001181004.1.100066 WP_001181004.1.100073 WP_001181004.1.100085 WP_001181004.1.10010 WP_001181004.1.100111 WP_001181004.1.100116 WP_001181004.1.100135 WP_001181004.1.100138 WP_001181004.1.100151 WP_001181004.1.100159 WP_001181004.1.100185 WP_001181004.1.100194 WP_001181004.1.100220 WP_001181004.1.100227 WP_001181004.1.100251 WP_001181004.1.100252 WP_001181004.1.100281 WP_001181004.1.100283 WP_001181004.1.100285 WP_001181004.1.100299 WP_001181004.1.100302 WP_001181004.1.100304 WP_001181004.1.100306 WP_001181004.1.100315 WP_001181004.1.10034 WP_001181004.1.100346 WP_001181004.1.100389 WP_001181004.1.100425 WP_001181004.1.100441 WP_001181004.1.100444 WP_001181004.1.100447 WP_001181004.1.100448 WP_001181004.1.100451 WP_001181004.1.100474 WP_001181004.1.10048 WP_001181004.1.100487 WP_001181004.1.100496 WP_001181004.1.100499 WP_001181004.1.100508 WP_001181004.1.10051 WP_001181004.1.100531 WP_001181004.1.100543 WP_001181004.1.100554 WP_001181004.1.100571 WP_001181004.1.100573 WP_001181004.1.100614 WP_001181004.1.100667 WP_001181004.1.10067 WP_001181004.1.10068 WP_001181004.1.100685 WP_001181004.1.100688 WP_001181004.1.100689 WP_001181004.1.100718 WP_001181004.1.100725 WP_001181004.1.100735 WP_001181004.1.100738 WP_001181004.1.100752 WP_001181004.1.100753 WP_001181004.1.100758 WP_001181004.1.100778 WP_001181004.1.100796 WP_001181004.1.10080 WP_001181004.1.100803 WP_001181004.1.100824 WP_001181004.1.100836 WP_001181004.1.100851 WP_001181004.1.100852 WP_001181004.1.10086 WP_001181004.1.100867 WP_001181004.1.100868 WP_001181004.1.100898 WP_001181004.1.100916 WP_001181004.1.100925 WP_001181004.1.100928 WP_001181004.1.100933 WP_001181004.1.10094 WP_001181004.1.100950 WP_001181004.1.100959 WP_001181004.1.100966 WP_001181004.1.100990 WP_001181004.1.10100 WP_001181004.1.101033 WP_001181004.1.101052 WP_001181004.1.101087 WP_001181004.1.101096 WP_001181004.1.1011 WP_001181004.1.101102 WP_001181004.1.101105 WP_001181004.1.101110 WP_001181004.1.101121 WP_001181004.1.101148 WP_001181004.1.101152 WP_001181004.1.101157 WP_001181004.1.101158 WP_001181004.1.101166 WP_001181004.1.101175 WP_001181004.1.101186 WP_001181004.1.101206 WP_001181004.1.101214 WP_001181004.1.101216 WP_001181004.1.101255 WP_001181004.1.101257 WP_001181004.1.10126 WP_001181004.1.101282 WP_001181004.1.101289 WP_001181004.1.101293 WP_001181004.1.10131 WP_001181004.1.101313 WP_001181004.1.101359 WP_001181004.1.10138 WP_001181004.1.101387 WP_001181004.1.101399 WP_001181004.1.101418 WP_001181004.1.101423 WP_001181004.1.101429 WP_001181004.1.101430 WP_001181004.1.101436 WP_001181004.1.101439 WP_001181004.1.101445 WP_001181004.1.101468 WP_001181004.1.101486 WP_001181004.1.101518 WP_001181004.1.101522 WP_001181004.1.10154 WP_001181004.1.101545 WP_001181004.1.101583 WP_001181004.1.101586 WP_001181004.1.101594 WP_001181004.1.101628 WP_001181004.1.101630 WP_001181004.1.101651 WP_001181004.1.101653 WP_001181004.1.101654 WP_001181004.1.101667 WP_001181004.1.101668 WP_001181004.1.101686 WP_001181004.1.101693 WP_001181004.1.101694 WP_001181004.1.101700 WP_001181004.1.101727 WP_001181004.1.10173 WP_001181004.1.101737 WP_001181004.1.101747 WP_001181004.1.101769 WP_001181004.1.101777 WP_001181004.1.101786 WP_001181004.1.10181 WP_001181004.1.101822 WP_001181004.1.10184 WP_001181004.1.101840 WP_001181004.1.101845 WP_001181004.1.101855 WP_001181004.1.101865 WP_001181004.1.10187 WP_001181004.1.10188 WP_001181004.1.101887 WP_001181004.1.101889 WP_001181004.1.10190 WP_001181004.1.101900 WP_001181004.1.101908 WP_001181004.1.101913 WP_001181004.1.101926 WP_001181004.1.101932 WP_001181004.1.101935 WP_001181004.1.101937 WP_001181004.1.101940 WP_001181004.1.101942 WP_001181004.1.101947 WP_001181004.1.101948 WP_001181004.1.101962 WP_001181004.1.101964 WP_001181004.1.101969 WP_001181004.1.101977 WP_001181004.1.101984 WP_001181004.1.101987 WP_001181004.1.102021 WP_001181004.1.102036 WP_001181004.1.10206 WP_001181004.1.102069 WP_001181004.1.102076 WP_001181004.1.102093 WP_001181004.1.102094 WP_001181004.1.102104 WP_001181004.1.102106 WP_001181004.1.102122 WP_001181004.1.102144 WP_001181004.1.10222 WP_001181004.1.10226 WP_001181004.1.10233 WP_001181004.1.10235 WP_001181004.1.10252 WP_001181004.1.10273 WP_001181004.1.10304 WP_001181004.1.10326 WP_001181004.1.10329 WP_001181004.1.10335 WP_001181004.1.10348 WP_001181004.1.10352 WP_001181004.1.10361 WP_001181004.1.10379 WP_001181004.1.10381 WP_001181004.1.1040 WP_001181004.1.10400 WP_001181004.1.10417 WP_001181004.1.10461 WP_001181004.1.10476 WP_001181004.1.10491 WP_001181004.1.10492 WP_001181004.1.10496 WP_001181004.1.10508 WP_001181004.1.10524 WP_001181004.1.10525 WP_001181004.1.10538 WP_001181004.1.10569 WP_001181004.1.10573 WP_001181004.1.10576 WP_001181004.1.10579 WP_001181004.1.1058 WP_001181004.1.10605 WP_001181004.1.10607 WP_001181004.1.10628 WP_001181004.1.10651 WP_001181004.1.10673 WP_001181004.1.10697 WP_001181004.1.10705 WP_001181004.1.1071 WP_001181004.1.10715 WP_001181004.1.10729 WP_001181004.1.1073 WP_001181004.1.1074 WP_001181004.1.10744 WP_001181004.1.10748 WP_001181004.1.10761 WP_001181004.1.10763 WP_001181004.1.10771 WP_001181004.1.10786 WP_001181004.1.10787 WP_001181004.1.10798 WP_001181004.1.10809 WP_001181004.1.10814 WP_001181004.1.10824 WP_001181004.1.10833 WP_001181004.1.10842 WP_001181004.1.10849 WP_001181004.1.10862 WP_001181004.1.10869 WP_001181004.1.10922 WP_001181004.1.10940 WP_001181004.1.10970 WP_001181004.1.10988 WP_001181004.1.10989 WP_001181004.1.10994 WP_001181004.1.10995 WP_001181004.1.11006 WP_001181004.1.11032 WP_001181004.1.11047 WP_001181004.1.11052 WP_001181004.1.11057 WP_001181004.1.11068 WP_001181004.1.11071 WP_001181004.1.11091 WP_001181004.1.1111 WP_001181004.1.11113 WP_001181004.1.11118 WP_001181004.1.11121 WP_001181004.1.1113 WP_001181004.1.11133 WP_001181004.1.112 WP_001181004.1.11217 WP_001181004.1.1122 WP_001181004.1.11240 WP_001181004.1.11241 WP_001181004.1.11250 WP_001181004.1.11251 WP_001181004.1.11265 WP_001181004.1.11272 WP_001181004.1.11285 WP_001181004.1.11296 WP_001181004.1.11301 WP_001181004.1.11315 WP_001181004.1.11323 WP_001181004.1.11399 WP_001181004.1.11408 WP_001181004.1.1141 WP_001181004.1.11411 WP_001181004.1.11418 WP_001181004.1.11420 WP_001181004.1.11436 WP_001181004.1.11437 WP_001181004.1.11440 WP_001181004.1.11452 WP_001181004.1.11467 WP_001181004.1.11499 WP_001181004.1.11519 WP_001181004.1.11524 WP_001181004.1.11531 WP_001181004.1.11542 WP_001181004.1.11575 WP_001181004.1.11578 WP_001181004.1.11595 WP_001181004.1.11607 WP_001181004.1.11608 WP_001181004.1.11612 WP_001181004.1.11616 WP_001181004.1.11645 WP_001181004.1.11671 WP_001181004.1.11673 WP_001181004.1.1168 WP_001181004.1.11690 WP_001181004.1.11699 WP_001181004.1.11748 WP_001181004.1.11759 WP_001181004.1.1176 WP_001181004.1.11762 WP_001181004.1.11801 WP_001181004.1.11803 WP_001181004.1.11844 WP_001181004.1.1186 WP_001181004.1.11912 WP_001181004.1.11948 WP_001181004.1.11949 WP_001181004.1.11955 WP_001181004.1.11956 WP_001181004.1.1196 WP_001181004.1.11981 WP_001181004.1.11982 WP_001181004.1.11985 WP_001181004.1.12000 WP_001181004.1.12009 WP_001181004.1.12010 WP_001181004.1.12030 WP_001181004.1.12036 WP_001181004.1.12050 WP_001181004.1.12051 WP_001181004.1.12060 WP_001181004.1.12076 WP_001181004.1.12088 WP_001181004.1.12095 WP_001181004.1.12111 WP_001181004.1.12112 WP_001181004.1.12115 WP_001181004.1.1212 WP_001181004.1.12151 WP_001181004.1.12157 WP_001181004.1.12174 WP_001181004.1.1218 WP_001181004.1.12204 WP_001181004.1.12230 WP_001181004.1.12259 WP_001181004.1.12268 WP_001181004.1.12279 WP_001181004.1.12292 WP_001181004.1.12295 WP_001181004.1.12305 WP_001181004.1.12319 WP_001181004.1.12320 WP_001181004.1.12342 WP_001181004.1.12344 WP_001181004.1.12352 WP_001181004.1.12415 WP_001181004.1.1242 WP_001181004.1.12426 WP_001181004.1.12458 WP_001181004.1.12459 WP_001181004.1.12468 WP_001181004.1.12478 WP_001181004.1.12542 WP_001181004.1.12552 WP_001181004.1.12558 WP_001181004.1.12566 WP_001181004.1.12574 WP_001181004.1.12582 WP_001181004.1.12594 WP_001181004.1.12623 WP_001181004.1.12645 WP_001181004.1.12646 WP_001181004.1.12675 WP_001181004.1.12679 WP_001181004.1.12680 WP_001181004.1.12693 WP_001181004.1.12697 WP_001181004.1.127 WP_001181004.1.12709 WP_001181004.1.12717 WP_001181004.1.12743 WP_001181004.1.12749 WP_001181004.1.1275 WP_001181004.1.12756 WP_001181004.1.12761 WP_001181004.1.12762 WP_001181004.1.12763 WP_001181004.1.12766 WP_001181004.1.12775 WP_001181004.1.1278 WP_001181004.1.12781 WP_001181004.1.1280 WP_001181004.1.12826 WP_001181004.1.12830 WP_001181004.1.12831 WP_001181004.1.12893 WP_001181004.1.12911 WP_001181004.1.12914 WP_001181004.1.12915 WP_001181004.1.12917 WP_001181004.1.12944 WP_001181004.1.1295 WP_001181004.1.12956 WP_001181004.1.12965 WP_001181004.1.12976 WP_001181004.1.12979 WP_001181004.1.12987 WP_001181004.1.12991 WP_001181004.1.13002 WP_001181004.1.13015 WP_001181004.1.13031 WP_001181004.1.13060 WP_001181004.1.13074 WP_001181004.1.1308 WP_001181004.1.13117 WP_001181004.1.1312 WP_001181004.1.13136 WP_001181004.1.1314 WP_001181004.1.13144 WP_001181004.1.1315 WP_001181004.1.13157 WP_001181004.1.13162 WP_001181004.1.13176 WP_001181004.1.13181 WP_001181004.1.13205 WP_001181004.1.13217 WP_001181004.1.13222 WP_001181004.1.13223 WP_001181004.1.1323 WP_001181004.1.13239 WP_001181004.1.13252 WP_001181004.1.13258 WP_001181004.1.13271 WP_001181004.1.13272 WP_001181004.1.13278 WP_001181004.1.13281 WP_001181004.1.13290 WP_001181004.1.13295 WP_001181004.1.13301 WP_001181004.1.13332 WP_001181004.1.13333 WP_001181004.1.13346 WP_001181004.1.13348 WP_001181004.1.1335 WP_001181004.1.13383 WP_001181004.1.13393 WP_001181004.1.13409 WP_001181004.1.13411 WP_001181004.1.1343 WP_001181004.1.13430 WP_001181004.1.13437 WP_001181004.1.13442 WP_001181004.1.1345 WP_001181004.1.13451 WP_001181004.1.13469 WP_001181004.1.13473 WP_001181004.1.13481 WP_001181004.1.13492 WP_001181004.1.13495 WP_001181004.1.13525 WP_001181004.1.13566 WP_001181004.1.13585 WP_001181004.1.13589 WP_001181004.1.13600 WP_001181004.1.13601 WP_001181004.1.13608 WP_001181004.1.13618 WP_001181004.1.13624 WP_001181004.1.13626 WP_001181004.1.13644 WP_001181004.1.13656 WP_001181004.1.13662 WP_001181004.1.13664 WP_001181004.1.13672 WP_001181004.1.13740 WP_001181004.1.13778 WP_001181004.1.13791 WP_001181004.1.13798 WP_001181004.1.13824 WP_001181004.1.13867 WP_001181004.1.13877 WP_001181004.1.13881 WP_001181004.1.13891 WP_001181004.1.13924 WP_001181004.1.13934 WP_001181004.1.13936 WP_001181004.1.13939 WP_001181004.1.13944 WP_001181004.1.13949 WP_001181004.1.13974 WP_001181004.1.13979 WP_001181004.1.13981 WP_001181004.1.14023 WP_001181004.1.14030 WP_001181004.1.14042 WP_001181004.1.14058 WP_001181004.1.14062 WP_001181004.1.14070 WP_001181004.1.14094 WP_001181004.1.14110 WP_001181004.1.14127 WP_001181004.1.14129 WP_001181004.1.14144 WP_001181004.1.14154 WP_001181004.1.14164 WP_001181004.1.1419 WP_001181004.1.14199 WP_001181004.1.142 WP_001181004.1.14245 WP_001181004.1.14253 WP_001181004.1.14277 WP_001181004.1.14292 WP_001181004.1.14299 WP_001181004.1.14304 WP_001181004.1.14322 WP_001181004.1.14331 WP_001181004.1.14346 WP_001181004.1.14371 WP_001181004.1.1438 WP_001181004.1.14389 WP_001181004.1.1439 WP_001181004.1.14398 WP_001181004.1.14417 WP_001181004.1.14432 WP_001181004.1.14445 WP_001181004.1.14451 WP_001181004.1.14453 WP_001181004.1.14468 WP_001181004.1.14493 WP_001181004.1.14499 WP_001181004.1.14501 WP_001181004.1.14506 WP_001181004.1.14508 WP_001181004.1.14509 WP_001181004.1.14529 WP_001181004.1.14536 WP_001181004.1.14538 WP_001181004.1.14581 WP_001181004.1.14582 WP_001181004.1.14600 WP_001181004.1.14605 WP_001181004.1.14607 WP_001181004.1.1461 WP_001181004.1.14616 WP_001181004.1.14621 WP_001181004.1.14648 WP_001181004.1.14661 WP_001181004.1.14672 WP_001181004.1.14678 WP_001181004.1.14687 WP_001181004.1.14693 WP_001181004.1.1470 WP_001181004.1.14711 WP_001181004.1.14712 WP_001181004.1.14746 WP_001181004.1.14748 WP_001181004.1.14749 WP_001181004.1.14807 WP_001181004.1.14811 WP_001181004.1.14833 WP_001181004.1.1486 WP_001181004.1.14861 WP_001181004.1.14871 WP_001181004.1.14879 WP_001181004.1.14914 WP_001181004.1.14934 WP_001181004.1.14935 WP_001181004.1.14946 WP_001181004.1.14956 WP_001181004.1.14958 WP_001181004.1.14963 WP_001181004.1.14965 WP_001181004.1.14992 WP_001181004.1.14993 WP_001181004.1.15007 WP_001181004.1.15020 WP_001181004.1.15041 WP_001181004.1.15068 WP_001181004.1.1508 WP_001181004.1.15087 WP_001181004.1.15090 WP_001181004.1.1510 WP_001181004.1.15117 WP_001181004.1.1512 WP_001181004.1.15138 WP_001181004.1.15148 WP_001181004.1.15177 WP_001181004.1.15191 WP_001181004.1.15193 WP_001181004.1.15207 WP_001181004.1.15221 WP_001181004.1.1524 WP_001181004.1.15245 WP_001181004.1.15252 WP_001181004.1.15259 WP_001181004.1.15270 WP_001181004.1.15274 WP_001181004.1.15277 WP_001181004.1.15282 WP_001181004.1.15287 WP_001181004.1.15290 WP_001181004.1.153 WP_001181004.1.15300 WP_001181004.1.15304 WP_001181004.1.15332 WP_001181004.1.15335 WP_001181004.1.15347 WP_001181004.1.15356 WP_001181004.1.15377 WP_001181004.1.15416 WP_001181004.1.15420 WP_001181004.1.1543 WP_001181004.1.15444 WP_001181004.1.15453 WP_001181004.1.15464 WP_001181004.1.15469 WP_001181004.1.15496 WP_001181004.1.1550 WP_001181004.1.15503 WP_001181004.1.15521 WP_001181004.1.15527 WP_001181004.1.15528 WP_001181004.1.15538 WP_001181004.1.15565 WP_001181004.1.15576 WP_001181004.1.15583 WP_001181004.1.1559 WP_001181004.1.15593 WP_001181004.1.15600 WP_001181004.1.1561 WP_001181004.1.15620 WP_001181004.1.15624 WP_001181004.1.15626 WP_001181004.1.15645 WP_001181004.1.15654 WP_001181004.1.15702 WP_001181004.1.15707 WP_001181004.1.15731 WP_001181004.1.15740 WP_001181004.1.15747 WP_001181004.1.15752 WP_001181004.1.15762 WP_001181004.1.15767 WP_001181004.1.15768 WP_001181004.1.15771 WP_001181004.1.15782 WP_001181004.1.15791 WP_001181004.1.1580 WP_001181004.1.15809 WP_001181004.1.1582 WP_001181004.1.15855 WP_001181004.1.15857 WP_001181004.1.15863 WP_001181004.1.15869 WP_001181004.1.1588 WP_001181004.1.15894 WP_001181004.1.15906 WP_001181004.1.15916 WP_001181004.1.15945 WP_001181004.1.15949 WP_001181004.1.15951 WP_001181004.1.15983 WP_001181004.1.15984 WP_001181004.1.15990 WP_001181004.1.16010 WP_001181004.1.16014 WP_001181004.1.16015 WP_001181004.1.16034 WP_001181004.1.1604 WP_001181004.1.16042 WP_001181004.1.16067 WP_001181004.1.16075 WP_001181004.1.16086 WP_001181004.1.16087 WP_001181004.1.1609 WP_001181004.1.16102 WP_001181004.1.16111 WP_001181004.1.16117 WP_001181004.1.16131 WP_001181004.1.16133 WP_001181004.1.16154 WP_001181004.1.16171 WP_001181004.1.16175 WP_001181004.1.16179 WP_001181004.1.16183 WP_001181004.1.16188 WP_001181004.1.16194 WP_001181004.1.1621 WP_001181004.1.1622 WP_001181004.1.16222 WP_001181004.1.16270 WP_001181004.1.16272 WP_001181004.1.16294 WP_001181004.1.163 WP_001181004.1.16303 WP_001181004.1.16322 WP_001181004.1.1634 WP_001181004.1.16387 WP_001181004.1.16388 WP_001181004.1.16396 WP_001181004.1.1640 WP_001181004.1.16435 WP_001181004.1.16463 WP_001181004.1.16482 WP_001181004.1.16500 WP_001181004.1.16517 WP_001181004.1.16532 WP_001181004.1.16539 WP_001181004.1.16541 WP_001181004.1.1655 WP_001181004.1.16577 WP_001181004.1.16592 WP_001181004.1.16604 WP_001181004.1.16608 WP_001181004.1.16612 WP_001181004.1.16640 WP_001181004.1.16648 WP_001181004.1.16667 WP_001181004.1.16669 WP_001181004.1.16682 WP_001181004.1.16685 WP_001181004.1.16700 WP_001181004.1.16705 WP_001181004.1.16715 WP_001181004.1.16721 WP_001181004.1.1673 WP_001181004.1.16745 WP_001181004.1.16752 WP_001181004.1.16766 WP_001181004.1.16780 WP_001181004.1.16798 WP_001181004.1.16799 WP_001181004.1.16805 WP_001181004.1.16807 WP_001181004.1.16818 WP_001181004.1.16843 WP_001181004.1.16845 WP_001181004.1.16861 WP_001181004.1.16862 WP_001181004.1.16894 WP_001181004.1.16927 WP_001181004.1.16970 WP_001181004.1.16979 WP_001181004.1.16992 WP_001181004.1.17014 WP_001181004.1.17017 WP_001181004.1.17018 WP_001181004.1.17028 WP_001181004.1.17042 WP_001181004.1.17061 WP_001181004.1.17084 WP_001181004.1.17085 WP_001181004.1.17087 WP_001181004.1.17089 WP_001181004.1.1710 WP_001181004.1.17101 WP_001181004.1.17102 WP_001181004.1.17109 WP_001181004.1.17111 WP_001181004.1.17114 WP_001181004.1.17119 WP_001181004.1.17123 WP_001181004.1.17150 WP_001181004.1.17153 WP_001181004.1.17170 WP_001181004.1.17172 WP_001181004.1.17182 WP_001181004.1.17186 WP_001181004.1.17187 WP_001181004.1.17205 WP_001181004.1.17206 WP_001181004.1.17216 WP_001181004.1.17230 WP_001181004.1.17241 WP_001181004.1.17242 WP_001181004.1.1726 WP_001181004.1.17267 WP_001181004.1.17282 WP_001181004.1.17290 WP_001181004.1.17297 WP_001181004.1.17300 WP_001181004.1.17301 WP_001181004.1.1731 WP_001181004.1.17325 WP_001181004.1.17333 WP_001181004.1.17356 WP_001181004.1.17360 WP_001181004.1.17373 WP_001181004.1.17386 WP_001181004.1.17387 WP_001181004.1.17389 WP_001181004.1.17392 WP_001181004.1.17403 WP_001181004.1.17410 WP_001181004.1.17415 WP_001181004.1.17417 WP_001181004.1.17432 WP_001181004.1.17441 WP_001181004.1.17461 WP_001181004.1.17464 WP_001181004.1.17496 WP_001181004.1.17515 WP_001181004.1.17534 WP_001181004.1.1754 WP_001181004.1.1755 WP_001181004.1.17550 WP_001181004.1.17568 WP_001181004.1.17570 WP_001181004.1.17577 WP_001181004.1.17584 WP_001181004.1.17595 WP_001181004.1.17623 WP_001181004.1.1763 WP_001181004.1.17637 WP_001181004.1.1766 WP_001181004.1.17680 WP_001181004.1.1769 WP_001181004.1.17701 WP_001181004.1.17711 WP_001181004.1.1772 WP_001181004.1.17734 WP_001181004.1.17757 WP_001181004.1.17765 WP_001181004.1.17766 WP_001181004.1.17769 WP_001181004.1.1778 WP_001181004.1.17802 WP_001181004.1.17829 WP_001181004.1.17831 WP_001181004.1.17836 WP_001181004.1.17849 WP_001181004.1.17889 WP_001181004.1.17904 WP_001181004.1.17920 WP_001181004.1.17925 WP_001181004.1.17937 WP_001181004.1.17952 WP_001181004.1.17961 WP_001181004.1.17963 WP_001181004.1.17984 WP_001181004.1.18000 WP_001181004.1.18006 WP_001181004.1.1802 WP_001181004.1.18024 WP_001181004.1.18050 WP_001181004.1.18064 WP_001181004.1.18094 WP_001181004.1.18112 WP_001181004.1.18118 WP_001181004.1.18121 WP_001181004.1.18133 WP_001181004.1.18136 WP_001181004.1.18164 WP_001181004.1.18175 WP_001181004.1.1821 WP_001181004.1.18225 WP_001181004.1.18226 WP_001181004.1.18229 WP_001181004.1.18275 WP_001181004.1.18311 WP_001181004.1.18316 WP_001181004.1.18326 WP_001181004.1.18329 WP_001181004.1.18337 WP_001181004.1.18338 WP_001181004.1.1834 WP_001181004.1.18340 WP_001181004.1.18348 WP_001181004.1.18354 WP_001181004.1.18381 WP_001181004.1.18383 WP_001181004.1.18394 WP_001181004.1.18402 WP_001181004.1.18410 WP_001181004.1.18420 WP_001181004.1.18428 WP_001181004.1.18436 WP_001181004.1.18438 WP_001181004.1.1844 WP_001181004.1.18458 WP_001181004.1.18461 WP_001181004.1.18472 WP_001181004.1.18482 WP_001181004.1.18511 WP_001181004.1.18519 WP_001181004.1.18530 WP_001181004.1.18550 WP_001181004.1.18556 WP_001181004.1.18581 WP_001181004.1.18583 WP_001181004.1.18588 WP_001181004.1.1861 WP_001181004.1.18617 WP_001181004.1.1862 WP_001181004.1.18628 WP_001181004.1.18649 WP_001181004.1.18650 WP_001181004.1.18651 WP_001181004.1.18655 WP_001181004.1.1866 WP_001181004.1.18666 WP_001181004.1.1867 WP_001181004.1.18675 WP_001181004.1.18699 WP_001181004.1.18714 WP_001181004.1.18725 WP_001181004.1.18726 WP_001181004.1.1873 WP_001181004.1.18794 WP_001181004.1.188 WP_001181004.1.18801 WP_001181004.1.18802 WP_001181004.1.18806 WP_001181004.1.1881 WP_001181004.1.18828 WP_001181004.1.18837 WP_001181004.1.18843 WP_001181004.1.18858 WP_001181004.1.18861 WP_001181004.1.18874 WP_001181004.1.18876 WP_001181004.1.18899 WP_001181004.1.18908 WP_001181004.1.18923 WP_001181004.1.18929 WP_001181004.1.18934 WP_001181004.1.18936 WP_001181004.1.1896 WP_001181004.1.18962 WP_001181004.1.18966 WP_001181004.1.18983 WP_001181004.1.18995 WP_001181004.1.19024 WP_001181004.1.1903 WP_001181004.1.19036 WP_001181004.1.19039 WP_001181004.1.1906 WP_001181004.1.19075 WP_001181004.1.1909 WP_001181004.1.19090 WP_001181004.1.191 WP_001181004.1.19100 WP_001181004.1.19113 WP_001181004.1.19114 WP_001181004.1.19122 WP_001181004.1.19129 WP_001181004.1.19135 WP_001181004.1.19140 WP_001181004.1.19146 WP_001181004.1.19147 WP_001181004.1.19148 WP_001181004.1.1915 WP_001181004.1.19150 WP_001181004.1.19153 WP_001181004.1.19171 WP_001181004.1.19194 WP_001181004.1.19205 WP_001181004.1.19206 WP_001181004.1.19245 WP_001181004.1.1925 WP_001181004.1.19276 WP_001181004.1.19277 WP_001181004.1.19297 WP_001181004.1.193 WP_001181004.1.19312 WP_001181004.1.19313 WP_001181004.1.19314 WP_001181004.1.19315 WP_001181004.1.19332 WP_001181004.1.19338 WP_001181004.1.19347 WP_001181004.1.19350 WP_001181004.1.19361 WP_001181004.1.19374 WP_001181004.1.19379 WP_001181004.1.19389 WP_001181004.1.19397 WP_001181004.1.19419 WP_001181004.1.19424 WP_001181004.1.19441 WP_001181004.1.19448 WP_001181004.1.19465 WP_001181004.1.19478 WP_001181004.1.19487 WP_001181004.1.19492 WP_001181004.1.19494 WP_001181004.1.1952 WP_001181004.1.19534 WP_001181004.1.19544 WP_001181004.1.19545 WP_001181004.1.19547 WP_001181004.1.19557 WP_001181004.1.19581 WP_001181004.1.19583 WP_001181004.1.19593 WP_001181004.1.1960 WP_001181004.1.19602 WP_001181004.1.19612 WP_001181004.1.1963 WP_001181004.1.19644 WP_001181004.1.19649 WP_001181004.1.19651 WP_001181004.1.19654 WP_001181004.1.19655 WP_001181004.1.19661 WP_001181004.1.19684 WP_001181004.1.19691 WP_001181004.1.19758 WP_001181004.1.19760 WP_001181004.1.19761 WP_001181004.1.19778 WP_001181004.1.19795 WP_001181004.1.1982 WP_001181004.1.19830 WP_001181004.1.19838 WP_001181004.1.19840 WP_001181004.1.19845 WP_001181004.1.19847 WP_001181004.1.19861 WP_001181004.1.1987 WP_001181004.1.19873 WP_001181004.1.19878 WP_001181004.1.19889 WP_001181004.1.19940 WP_001181004.1.19945 WP_001181004.1.19957 WP_001181004.1.19972 WP_001181004.1.19994 WP_001181004.1.20025 WP_001181004.1.2005 WP_001181004.1.20096 WP_001181004.1.20114 WP_001181004.1.20115 WP_001181004.1.20129 WP_001181004.1.20133 WP_001181004.1.20136 WP_001181004.1.2015 WP_001181004.1.20151 WP_001181004.1.20157 WP_001181004.1.20159 WP_001181004.1.20164 WP_001181004.1.20166 WP_001181004.1.20170 WP_001181004.1.20178 WP_001181004.1.20183 WP_001181004.1.20192 WP_001181004.1.20215 WP_001181004.1.2022 WP_001181004.1.20224 WP_001181004.1.20230 WP_001181004.1.20238 WP_001181004.1.20251 WP_001181004.1.20264 WP_001181004.1.2027 WP_001181004.1.20277 WP_001181004.1.20289 WP_001181004.1.20290 WP_001181004.1.20308 WP_001181004.1.20318 WP_001181004.1.20325 WP_001181004.1.20331 WP_001181004.1.20334 WP_001181004.1.20370 WP_001181004.1.20388 WP_001181004.1.20442 WP_001181004.1.20445 WP_001181004.1.20449 WP_001181004.1.20452 WP_001181004.1.20480 WP_001181004.1.20483 WP_001181004.1.20484 WP_001181004.1.20493 WP_001181004.1.20506 WP_001181004.1.20515 WP_001181004.1.20519 WP_001181004.1.20536 WP_001181004.1.20546 WP_001181004.1.20549 WP_001181004.1.20565 WP_001181004.1.20575 WP_001181004.1.20594 WP_001181004.1.20596 WP_001181004.1.20609 WP_001181004.1.2063 WP_001181004.1.20630 WP_001181004.1.20636 WP_001181004.1.20638 WP_001181004.1.20640 WP_001181004.1.20662 WP_001181004.1.20668 WP_001181004.1.20691 WP_001181004.1.20709 WP_001181004.1.20724 WP_001181004.1.20730 WP_001181004.1.20737 WP_001181004.1.20741 WP_001181004.1.20745 WP_001181004.1.2075 WP_001181004.1.20761 WP_001181004.1.20765 WP_001181004.1.20784 WP_001181004.1.20785 WP_001181004.1.20803 WP_001181004.1.20813 WP_001181004.1.20818 WP_001181004.1.20824 WP_001181004.1.20831 WP_001181004.1.20841 WP_001181004.1.20848 WP_001181004.1.20863 WP_001181004.1.2089 WP_001181004.1.20893 WP_001181004.1.20907 WP_001181004.1.2092 WP_001181004.1.2093 WP_001181004.1.20933 WP_001181004.1.2094 WP_001181004.1.20941 WP_001181004.1.20943 WP_001181004.1.20950 WP_001181004.1.20958 WP_001181004.1.20962 WP_001181004.1.20982 WP_001181004.1.20989 WP_001181004.1.2100 WP_001181004.1.21017 WP_001181004.1.21020 WP_001181004.1.21022 WP_001181004.1.21024 WP_001181004.1.21029 WP_001181004.1.21033 WP_001181004.1.21041 WP_001181004.1.21057 WP_001181004.1.21059 WP_001181004.1.21104 WP_001181004.1.21122 WP_001181004.1.2113 WP_001181004.1.21131 WP_001181004.1.21137 WP_001181004.1.21152 WP_001181004.1.21171 WP_001181004.1.21197 WP_001181004.1.21236 WP_001181004.1.21248 WP_001181004.1.21251 WP_001181004.1.21255 WP_001181004.1.21266 WP_001181004.1.21273 WP_001181004.1.21277 WP_001181004.1.21305 WP_001181004.1.21320 WP_001181004.1.21336 WP_001181004.1.21378 WP_001181004.1.21395 WP_001181004.1.2142 WP_001181004.1.21441 WP_001181004.1.21450 WP_001181004.1.21455 WP_001181004.1.21470 WP_001181004.1.21508 WP_001181004.1.21519 WP_001181004.1.21526 WP_001181004.1.2153 WP_001181004.1.21537 WP_001181004.1.2156 WP_001181004.1.21573 WP_001181004.1.21578 WP_001181004.1.21596 WP_001181004.1.21614 WP_001181004.1.21628 WP_001181004.1.21634 WP_001181004.1.21637 WP_001181004.1.2164 WP_001181004.1.21652 WP_001181004.1.21656 WP_001181004.1.21661 WP_001181004.1.21666 WP_001181004.1.21667 WP_001181004.1.21668 WP_001181004.1.21673 WP_001181004.1.21696 WP_001181004.1.21714 WP_001181004.1.21727 WP_001181004.1.21729 WP_001181004.1.21732 WP_001181004.1.21733 WP_001181004.1.21756 WP_001181004.1.21758 WP_001181004.1.21762 WP_001181004.1.21771 WP_001181004.1.21773 WP_001181004.1.21811 WP_001181004.1.21812 WP_001181004.1.21823 WP_001181004.1.21887 WP_001181004.1.21895 WP_001181004.1.21899 WP_001181004.1.21915 WP_001181004.1.21945 WP_001181004.1.21948 WP_001181004.1.21962 WP_001181004.1.2198 WP_001181004.1.21986 WP_001181004.1.21992 WP_001181004.1.22021 WP_001181004.1.22042 WP_001181004.1.22060 WP_001181004.1.22088 WP_001181004.1.22098 WP_001181004.1.22113 WP_001181004.1.22161 WP_001181004.1.2218 WP_001181004.1.22182 WP_001181004.1.22189 WP_001181004.1.22195 WP_001181004.1.22203 WP_001181004.1.22204 WP_001181004.1.22251 WP_001181004.1.22268 WP_001181004.1.22269 WP_001181004.1.22272 WP_001181004.1.22280 WP_001181004.1.22291 WP_001181004.1.22293 WP_001181004.1.22295 WP_001181004.1.22304 WP_001181004.1.22314 WP_001181004.1.2232 WP_001181004.1.22325 WP_001181004.1.22328 WP_001181004.1.22350 WP_001181004.1.22359 WP_001181004.1.22363 WP_001181004.1.22381 WP_001181004.1.22409 WP_001181004.1.2242 WP_001181004.1.22431 WP_001181004.1.2245 WP_001181004.1.22450 WP_001181004.1.22464 WP_001181004.1.22470 WP_001181004.1.22494 WP_001181004.1.22501 WP_001181004.1.22508 WP_001181004.1.22522 WP_001181004.1.22543 WP_001181004.1.22544 WP_001181004.1.22549 WP_001181004.1.22571 WP_001181004.1.22572 WP_001181004.1.22574 WP_001181004.1.22576 WP_001181004.1.22579 WP_001181004.1.22594 WP_001181004.1.22599 WP_001181004.1.22602 WP_001181004.1.22632 WP_001181004.1.22641 WP_001181004.1.22649 WP_001181004.1.22662 WP_001181004.1.22667 WP_001181004.1.22669 WP_001181004.1.22685 WP_001181004.1.22690 WP_001181004.1.22691 WP_001181004.1.22743 WP_001181004.1.22756 WP_001181004.1.22757 WP_001181004.1.22759 WP_001181004.1.22765 WP_001181004.1.22771 WP_001181004.1.22777 WP_001181004.1.22783 WP_001181004.1.22809 WP_001181004.1.22814 WP_001181004.1.22824 WP_001181004.1.22827 WP_001181004.1.22830 WP_001181004.1.22846 WP_001181004.1.22868 WP_001181004.1.22875 WP_001181004.1.22878 WP_001181004.1.22885 WP_001181004.1.22896 WP_001181004.1.22908 WP_001181004.1.22917 WP_001181004.1.22925 WP_001181004.1.22939 WP_001181004.1.22961 WP_001181004.1.22988 WP_001181004.1.22990 WP_001181004.1.22993 WP_001181004.1.2300 WP_001181004.1.23005 WP_001181004.1.23021 WP_001181004.1.23026 WP_001181004.1.23035 WP_001181004.1.23042 WP_001181004.1.23044 WP_001181004.1.23045 WP_001181004.1.23057 WP_001181004.1.23062 WP_001181004.1.23073 WP_001181004.1.23078 WP_001181004.1.23081 WP_001181004.1.23090 WP_001181004.1.23092 WP_001181004.1.23105 WP_001181004.1.23109 WP_001181004.1.23115 WP_001181004.1.23120 WP_001181004.1.23135 WP_001181004.1.2322 WP_001181004.1.23230 WP_001181004.1.23241 WP_001181004.1.2325 WP_001181004.1.23257 WP_001181004.1.23270 WP_001181004.1.23282 WP_001181004.1.23285 WP_001181004.1.23290 WP_001181004.1.23293 WP_001181004.1.23299 WP_001181004.1.23323 WP_001181004.1.23330 WP_001181004.1.23351 WP_001181004.1.23352 WP_001181004.1.23355 WP_001181004.1.23376 WP_001181004.1.23378 WP_001181004.1.23383 WP_001181004.1.23386 WP_001181004.1.23388 WP_001181004.1.23393 WP_001181004.1.23435 WP_001181004.1.23443 WP_001181004.1.23456 WP_001181004.1.23463 WP_001181004.1.23467 WP_001181004.1.23486 WP_001181004.1.23487 WP_001181004.1.23511 WP_001181004.1.23520 WP_001181004.1.23522 WP_001181004.1.23527 WP_001181004.1.2353 WP_001181004.1.23549 WP_001181004.1.23554 WP_001181004.1.23561 WP_001181004.1.23563 WP_001181004.1.23575 WP_001181004.1.23584 WP_001181004.1.23593 WP_001181004.1.2362 WP_001181004.1.23622 WP_001181004.1.23625 WP_001181004.1.23640 WP_001181004.1.23660 WP_001181004.1.23676 WP_001181004.1.23686 WP_001181004.1.23693 WP_001181004.1.23700 WP_001181004.1.23711 WP_001181004.1.23724 WP_001181004.1.23729 WP_001181004.1.23741 WP_001181004.1.23752 WP_001181004.1.23754 WP_001181004.1.23765 WP_001181004.1.23790 WP_001181004.1.23795 WP_001181004.1.23804 WP_001181004.1.23806 WP_001181004.1.23812 WP_001181004.1.23838 WP_001181004.1.23840 WP_001181004.1.23855 WP_001181004.1.23869 WP_001181004.1.2388 WP_001181004.1.23881 WP_001181004.1.23886 WP_001181004.1.23890 WP_001181004.1.23895 WP_001181004.1.23898 WP_001181004.1.23899 WP_001181004.1.23914 WP_001181004.1.23915 WP_001181004.1.23931 WP_001181004.1.23945 WP_001181004.1.2395 WP_001181004.1.23950 WP_001181004.1.23953 WP_001181004.1.23960 WP_001181004.1.23962 WP_001181004.1.23970 WP_001181004.1.23971 WP_001181004.1.23973 WP_001181004.1.23984 WP_001181004.1.23985 WP_001181004.1.24 WP_001181004.1.24004 WP_001181004.1.24024 WP_001181004.1.24038 WP_001181004.1.24045 WP_001181004.1.24051 WP_001181004.1.24058 WP_001181004.1.24068 WP_001181004.1.24070 WP_001181004.1.24088 WP_001181004.1.24089 WP_001181004.1.24120 WP_001181004.1.24122 WP_001181004.1.24124 WP_001181004.1.24127 WP_001181004.1.2413 WP_001181004.1.24136 WP_001181004.1.24169 WP_001181004.1.24177 WP_001181004.1.2418 WP_001181004.1.24194 WP_001181004.1.24233 WP_001181004.1.24278 WP_001181004.1.2428 WP_001181004.1.24283 WP_001181004.1.24290 WP_001181004.1.2430 WP_001181004.1.24304 WP_001181004.1.24316 WP_001181004.1.2433 WP_001181004.1.24341 WP_001181004.1.24362 WP_001181004.1.2437 WP_001181004.1.24374 WP_001181004.1.24381 WP_001181004.1.24383 WP_001181004.1.24458 WP_001181004.1.24460 WP_001181004.1.24473 WP_001181004.1.24483 WP_001181004.1.24485 WP_001181004.1.2449 WP_001181004.1.24499 WP_001181004.1.24523 WP_001181004.1.24524 WP_001181004.1.24533 WP_001181004.1.24536 WP_001181004.1.24547 WP_001181004.1.2456 WP_001181004.1.24560 WP_001181004.1.24570 WP_001181004.1.24575 WP_001181004.1.24577 WP_001181004.1.24583 WP_001181004.1.24592 WP_001181004.1.24616 WP_001181004.1.24634 WP_001181004.1.24641 WP_001181004.1.24642 WP_001181004.1.24646 WP_001181004.1.24650 WP_001181004.1.2469 WP_001181004.1.24693 WP_001181004.1.24695 WP_001181004.1.24703 WP_001181004.1.24752 WP_001181004.1.24753 WP_001181004.1.24758 WP_001181004.1.24763 WP_001181004.1.24773 WP_001181004.1.24783 WP_001181004.1.2479 WP_001181004.1.24791 WP_001181004.1.24797 WP_001181004.1.24799 WP_001181004.1.24808 WP_001181004.1.24849 WP_001181004.1.24854 WP_001181004.1.24870 WP_001181004.1.24876 WP_001181004.1.24899 WP_001181004.1.24902 WP_001181004.1.24906 WP_001181004.1.24909 WP_001181004.1.24926 WP_001181004.1.24929 WP_001181004.1.24939 WP_001181004.1.24946 WP_001181004.1.24960 WP_001181004.1.24968 WP_001181004.1.24979 WP_001181004.1.24981 WP_001181004.1.24982 WP_001181004.1.24984 WP_001181004.1.25019 WP_001181004.1.2502 WP_001181004.1.25021 WP_001181004.1.25038 WP_001181004.1.25039 WP_001181004.1.2504 WP_001181004.1.25042 WP_001181004.1.25050 WP_001181004.1.25060 WP_001181004.1.25076 WP_001181004.1.25079 WP_001181004.1.25082 WP_001181004.1.25085 WP_001181004.1.25086 WP_001181004.1.25087 WP_001181004.1.25088 WP_001181004.1.2512 WP_001181004.1.25126 WP_001181004.1.25141 WP_001181004.1.25174 WP_001181004.1.25183 WP_001181004.1.25193 WP_001181004.1.25201 WP_001181004.1.25203 WP_001181004.1.25204 WP_001181004.1.25248 WP_001181004.1.25270 WP_001181004.1.25272 WP_001181004.1.25289 WP_001181004.1.25305 WP_001181004.1.2531 WP_001181004.1.25312 WP_001181004.1.25324 WP_001181004.1.25346 WP_001181004.1.2537 WP_001181004.1.25372 WP_001181004.1.25378 WP_001181004.1.25380 WP_001181004.1.254 WP_001181004.1.2540 WP_001181004.1.25403 WP_001181004.1.25414 WP_001181004.1.25420 WP_001181004.1.2543 WP_001181004.1.25446 WP_001181004.1.25480 WP_001181004.1.255 WP_001181004.1.25517 WP_001181004.1.25525 WP_001181004.1.25526 WP_001181004.1.25548 WP_001181004.1.25577 WP_001181004.1.2558 WP_001181004.1.25592 WP_001181004.1.25598 WP_001181004.1.25602 WP_001181004.1.25612 WP_001181004.1.25613 WP_001181004.1.25631 WP_001181004.1.25643 WP_001181004.1.25652 WP_001181004.1.2567 WP_001181004.1.25680 WP_001181004.1.25681 WP_001181004.1.25701 WP_001181004.1.25712 WP_001181004.1.25713 WP_001181004.1.25717 WP_001181004.1.25718 WP_001181004.1.25724 WP_001181004.1.25726 WP_001181004.1.25750 WP_001181004.1.25753 WP_001181004.1.25755 WP_001181004.1.25794 WP_001181004.1.25799 WP_001181004.1.25819 WP_001181004.1.25831 WP_001181004.1.25832 WP_001181004.1.25843 WP_001181004.1.25855 WP_001181004.1.25869 WP_001181004.1.25873 WP_001181004.1.2588 WP_001181004.1.25886 WP_001181004.1.2589 WP_001181004.1.25890 WP_001181004.1.25895 WP_001181004.1.25915 WP_001181004.1.25945 WP_001181004.1.2597 WP_001181004.1.25996 WP_001181004.1.26005 WP_001181004.1.26040 WP_001181004.1.26048 WP_001181004.1.26055 WP_001181004.1.2606 WP_001181004.1.26061 WP_001181004.1.26066 WP_001181004.1.26076 WP_001181004.1.26092 WP_001181004.1.26100 WP_001181004.1.26105 WP_001181004.1.2612 WP_001181004.1.26121 WP_001181004.1.26125 WP_001181004.1.26130 WP_001181004.1.26131 WP_001181004.1.26134 WP_001181004.1.26135 WP_001181004.1.26150 WP_001181004.1.26161 WP_001181004.1.26175 WP_001181004.1.26186 WP_001181004.1.26189 WP_001181004.1.26191 WP_001181004.1.26196 WP_001181004.1.26246 WP_001181004.1.26259 WP_001181004.1.26262 WP_001181004.1.26264 WP_001181004.1.26270 WP_001181004.1.26284 WP_001181004.1.26304 WP_001181004.1.26325 WP_001181004.1.26331 WP_001181004.1.2637 WP_001181004.1.26379 WP_001181004.1.26391 WP_001181004.1.26398 WP_001181004.1.26401 WP_001181004.1.26403 WP_001181004.1.26419 WP_001181004.1.2642 WP_001181004.1.26438 WP_001181004.1.26443 WP_001181004.1.26467 WP_001181004.1.26474 WP_001181004.1.26479 WP_001181004.1.26480 WP_001181004.1.26517 WP_001181004.1.26525 WP_001181004.1.26569 WP_001181004.1.26570 WP_001181004.1.26574 WP_001181004.1.26575 WP_001181004.1.26579 WP_001181004.1.26588 WP_001181004.1.26590 WP_001181004.1.26598 WP_001181004.1.26609 WP_001181004.1.26613 WP_001181004.1.26627 WP_001181004.1.26644 WP_001181004.1.2665 WP_001181004.1.26658 WP_001181004.1.26659 WP_001181004.1.26660 WP_001181004.1.26683 WP_001181004.1.26688 WP_001181004.1.26716 WP_001181004.1.26720 WP_001181004.1.26736 WP_001181004.1.26761 WP_001181004.1.26766 WP_001181004.1.26782 WP_001181004.1.26837 WP_001181004.1.26839 WP_001181004.1.26861 WP_001181004.1.26878 WP_001181004.1.2688 WP_001181004.1.26912 WP_001181004.1.26932 WP_001181004.1.2694 WP_001181004.1.26941 WP_001181004.1.26943 WP_001181004.1.2695 WP_001181004.1.26950 WP_001181004.1.26975 WP_001181004.1.26987 WP_001181004.1.26995 WP_001181004.1.26998 WP_001181004.1.2700 WP_001181004.1.27019 WP_001181004.1.27043 WP_001181004.1.27057 WP_001181004.1.27060 WP_001181004.1.27091 WP_001181004.1.27098 WP_001181004.1.27101 WP_001181004.1.27105 WP_001181004.1.2712 WP_001181004.1.27134 WP_001181004.1.27141 WP_001181004.1.27148 WP_001181004.1.27175 WP_001181004.1.27188 WP_001181004.1.27214 WP_001181004.1.27234 WP_001181004.1.27260 WP_001181004.1.27280 WP_001181004.1.27283 WP_001181004.1.27287 WP_001181004.1.27292 WP_001181004.1.2731 WP_001181004.1.27310 WP_001181004.1.27313 WP_001181004.1.27330 WP_001181004.1.27338 WP_001181004.1.27367 WP_001181004.1.27373 WP_001181004.1.27396 WP_001181004.1.27401 WP_001181004.1.27424 WP_001181004.1.27426 WP_001181004.1.27445 WP_001181004.1.2745 WP_001181004.1.27451 WP_001181004.1.27472 WP_001181004.1.27504 WP_001181004.1.27518 WP_001181004.1.27520 WP_001181004.1.27524 WP_001181004.1.2755 WP_001181004.1.27560 WP_001181004.1.27580 WP_001181004.1.27585 WP_001181004.1.27611 WP_001181004.1.27618 WP_001181004.1.27683 WP_001181004.1.27691 WP_001181004.1.27693 WP_001181004.1.27698 WP_001181004.1.27723 WP_001181004.1.27734 WP_001181004.1.27741 WP_001181004.1.27742 WP_001181004.1.27749 WP_001181004.1.27758 WP_001181004.1.27774 WP_001181004.1.27786 WP_001181004.1.2779 WP_001181004.1.27797 WP_001181004.1.2782 WP_001181004.1.27846 WP_001181004.1.27856 WP_001181004.1.27861 WP_001181004.1.27871 WP_001181004.1.27876 WP_001181004.1.27879 WP_001181004.1.27897 WP_001181004.1.27911 WP_001181004.1.27913 WP_001181004.1.27923 WP_001181004.1.27932 WP_001181004.1.2794 WP_001181004.1.27957 WP_001181004.1.27971 WP_001181004.1.28008 WP_001181004.1.28026 WP_001181004.1.28027 WP_001181004.1.28046 WP_001181004.1.28051 WP_001181004.1.28102 WP_001181004.1.28109 WP_001181004.1.2811 WP_001181004.1.28110 WP_001181004.1.28128 WP_001181004.1.28143 WP_001181004.1.28145 WP_001181004.1.28156 WP_001181004.1.28167 WP_001181004.1.28168 WP_001181004.1.28184 WP_001181004.1.28199 WP_001181004.1.2823 WP_001181004.1.28250 WP_001181004.1.2826 WP_001181004.1.28268 WP_001181004.1.28271 WP_001181004.1.28305 WP_001181004.1.28314 WP_001181004.1.28318 WP_001181004.1.28322 WP_001181004.1.28345 WP_001181004.1.28349 WP_001181004.1.28371 WP_001181004.1.2838 WP_001181004.1.28401 WP_001181004.1.28414 WP_001181004.1.28433 WP_001181004.1.28440 WP_001181004.1.28461 WP_001181004.1.28476 WP_001181004.1.28480 WP_001181004.1.28491 WP_001181004.1.28496 WP_001181004.1.285 WP_001181004.1.28500 WP_001181004.1.28509 WP_001181004.1.28523 WP_001181004.1.28536 WP_001181004.1.28540 WP_001181004.1.28544 WP_001181004.1.28551 WP_001181004.1.28554 WP_001181004.1.28568 WP_001181004.1.28639 WP_001181004.1.2866 WP_001181004.1.28662 WP_001181004.1.28683 WP_001181004.1.28697 WP_001181004.1.28711 WP_001181004.1.28723 WP_001181004.1.28732 WP_001181004.1.28734 WP_001181004.1.28736 WP_001181004.1.28742 WP_001181004.1.28760 WP_001181004.1.28762 WP_001181004.1.28769 WP_001181004.1.28791 WP_001181004.1.28809 WP_001181004.1.2881 WP_001181004.1.28829 WP_001181004.1.28835 WP_001181004.1.28842 WP_001181004.1.28863 WP_001181004.1.28879 WP_001181004.1.28919 WP_001181004.1.28924 WP_001181004.1.28950 WP_001181004.1.28953 WP_001181004.1.28982 WP_001181004.1.28994 WP_001181004.1.290 WP_001181004.1.29001 WP_001181004.1.29013 WP_001181004.1.29016 WP_001181004.1.29026 WP_001181004.1.29049 WP_001181004.1.29061 WP_001181004.1.29079 WP_001181004.1.29082 WP_001181004.1.291 WP_001181004.1.29100 WP_001181004.1.29118 WP_001181004.1.29125 WP_001181004.1.29126 WP_001181004.1.29128 WP_001181004.1.29146 WP_001181004.1.29150 WP_001181004.1.29164 WP_001181004.1.29176 WP_001181004.1.29194 WP_001181004.1.29197 WP_001181004.1.29202 WP_001181004.1.29206 WP_001181004.1.29221 WP_001181004.1.29230 WP_001181004.1.29239 WP_001181004.1.29252 WP_001181004.1.29258 WP_001181004.1.2926 WP_001181004.1.2931 WP_001181004.1.29341 WP_001181004.1.29377 WP_001181004.1.29394 WP_001181004.1.29404 WP_001181004.1.2942 WP_001181004.1.29429 WP_001181004.1.29443 WP_001181004.1.2945 WP_001181004.1.29486 WP_001181004.1.29495 WP_001181004.1.29497 WP_001181004.1.29503 WP_001181004.1.29504 WP_001181004.1.29513 WP_001181004.1.2952 WP_001181004.1.29523 WP_001181004.1.2954 WP_001181004.1.29556 WP_001181004.1.29564 WP_001181004.1.29590 WP_001181004.1.29597 WP_001181004.1.29603 WP_001181004.1.29618 WP_001181004.1.2963 WP_001181004.1.29643 WP_001181004.1.29647 WP_001181004.1.29662 WP_001181004.1.29669 WP_001181004.1.29683 WP_001181004.1.29689 WP_001181004.1.29699 WP_001181004.1.29715 WP_001181004.1.29724 WP_001181004.1.29740 WP_001181004.1.29746 WP_001181004.1.29752 WP_001181004.1.2978 WP_001181004.1.29798 WP_001181004.1.29812 WP_001181004.1.29815 WP_001181004.1.29818 WP_001181004.1.29819 WP_001181004.1.29820 WP_001181004.1.29821 WP_001181004.1.29840 WP_001181004.1.29855 WP_001181004.1.2986 WP_001181004.1.29874 WP_001181004.1.29876 WP_001181004.1.29884 WP_001181004.1.29893 WP_001181004.1.29933 WP_001181004.1.2995 WP_001181004.1.29967 WP_001181004.1.29976 WP_001181004.1.29979 WP_001181004.1.29988 WP_001181004.1.29992 WP_001181004.1.30 WP_001181004.1.30004 WP_001181004.1.30016 WP_001181004.1.30019 WP_001181004.1.30035 WP_001181004.1.30052 WP_001181004.1.30063 WP_001181004.1.30064 WP_001181004.1.30098 WP_001181004.1.30105 WP_001181004.1.30123 WP_001181004.1.30141 WP_001181004.1.30164 WP_001181004.1.30178 WP_001181004.1.3018 WP_001181004.1.30221 WP_001181004.1.30222 WP_001181004.1.30231 WP_001181004.1.30232 WP_001181004.1.30239 WP_001181004.1.30247 WP_001181004.1.30253 WP_001181004.1.30269 WP_001181004.1.30298 WP_001181004.1.30347 WP_001181004.1.30391 WP_001181004.1.30397 WP_001181004.1.30399 WP_001181004.1.30400 WP_001181004.1.30401 WP_001181004.1.30428 WP_001181004.1.30447 WP_001181004.1.3045 WP_001181004.1.30452 WP_001181004.1.30472 WP_001181004.1.30476 WP_001181004.1.30479 WP_001181004.1.30497 WP_001181004.1.30524 WP_001181004.1.30536 WP_001181004.1.30546 WP_001181004.1.3055 WP_001181004.1.30550 WP_001181004.1.30554 WP_001181004.1.30570 WP_001181004.1.30580 WP_001181004.1.306 WP_001181004.1.3063 WP_001181004.1.30630 WP_001181004.1.30637 WP_001181004.1.30639 WP_001181004.1.30640 WP_001181004.1.30658 WP_001181004.1.30665 WP_001181004.1.30691 WP_001181004.1.30700 WP_001181004.1.30733 WP_001181004.1.30742 WP_001181004.1.30749 WP_001181004.1.30762 WP_001181004.1.30783 WP_001181004.1.30808 WP_001181004.1.3083 WP_001181004.1.30843 WP_001181004.1.30853 WP_001181004.1.30866 WP_001181004.1.30867 WP_001181004.1.30879 WP_001181004.1.30887 WP_001181004.1.30896 WP_001181004.1.309 WP_001181004.1.30905 WP_001181004.1.30906 WP_001181004.1.30918 WP_001181004.1.30960 WP_001181004.1.30987 WP_001181004.1.30993 WP_001181004.1.30999 WP_001181004.1.31000 WP_001181004.1.31009 WP_001181004.1.31017 WP_001181004.1.31026 WP_001181004.1.31029 WP_001181004.1.31055 WP_001181004.1.31083 WP_001181004.1.31089 WP_001181004.1.31119 WP_001181004.1.31129 WP_001181004.1.31142 WP_001181004.1.31149 WP_001181004.1.31154 WP_001181004.1.31188 WP_001181004.1.312 WP_001181004.1.31211 WP_001181004.1.31252 WP_001181004.1.31295 WP_001181004.1.31319 WP_001181004.1.31340 WP_001181004.1.31347 WP_001181004.1.31353 WP_001181004.1.31357 WP_001181004.1.31372 WP_001181004.1.31379 WP_001181004.1.3140 WP_001181004.1.31401 WP_001181004.1.31407 WP_001181004.1.31419 WP_001181004.1.31421 WP_001181004.1.31422 WP_001181004.1.31429 WP_001181004.1.31431 WP_001181004.1.31433 WP_001181004.1.31434 WP_001181004.1.3147 WP_001181004.1.31482 WP_001181004.1.31506 WP_001181004.1.31511 WP_001181004.1.31518 WP_001181004.1.31521 WP_001181004.1.31527 WP_001181004.1.31542 WP_001181004.1.31557 WP_001181004.1.31559 WP_001181004.1.31575 WP_001181004.1.31596 WP_001181004.1.31614 WP_001181004.1.31618 WP_001181004.1.31625 WP_001181004.1.31639 WP_001181004.1.31657 WP_001181004.1.31675 WP_001181004.1.31679 WP_001181004.1.31681 WP_001181004.1.3169 WP_001181004.1.31696 WP_001181004.1.31709 WP_001181004.1.31715 WP_001181004.1.31736 WP_001181004.1.31740 WP_001181004.1.3176 WP_001181004.1.31801 WP_001181004.1.31803 WP_001181004.1.31809 WP_001181004.1.3181 WP_001181004.1.31823 WP_001181004.1.31825 WP_001181004.1.31833 WP_001181004.1.31835 WP_001181004.1.31839 WP_001181004.1.31860 WP_001181004.1.31863 WP_001181004.1.31866 WP_001181004.1.31878 WP_001181004.1.31898 WP_001181004.1.31899 WP_001181004.1.31903 WP_001181004.1.31924 WP_001181004.1.31928 WP_001181004.1.3193 WP_001181004.1.31937 WP_001181004.1.31978 WP_001181004.1.3201 WP_001181004.1.32020 WP_001181004.1.32021 WP_001181004.1.32024 WP_001181004.1.3203 WP_001181004.1.32030 WP_001181004.1.32037 WP_001181004.1.32049 WP_001181004.1.32063 WP_001181004.1.32078 WP_001181004.1.32089 WP_001181004.1.32091 WP_001181004.1.32093 WP_001181004.1.32094 WP_001181004.1.3212 WP_001181004.1.32121 WP_001181004.1.32127 WP_001181004.1.32138 WP_001181004.1.32142 WP_001181004.1.32143 WP_001181004.1.3215 WP_001181004.1.32173 WP_001181004.1.32184 WP_001181004.1.322 WP_001181004.1.32222 WP_001181004.1.32225 WP_001181004.1.32232 WP_001181004.1.32234 WP_001181004.1.32236 WP_001181004.1.32242 WP_001181004.1.32243 WP_001181004.1.32279 WP_001181004.1.32287 WP_001181004.1.3233 WP_001181004.1.32333 WP_001181004.1.32394 WP_001181004.1.32406 WP_001181004.1.32432 WP_001181004.1.32435 WP_001181004.1.32443 WP_001181004.1.32448 WP_001181004.1.3247 WP_001181004.1.32475 WP_001181004.1.32478 WP_001181004.1.32479 WP_001181004.1.3248 WP_001181004.1.32480 WP_001181004.1.32494 WP_001181004.1.32509 WP_001181004.1.32518 WP_001181004.1.32536 WP_001181004.1.32558 WP_001181004.1.32561 WP_001181004.1.32574 WP_001181004.1.32580 WP_001181004.1.32587 WP_001181004.1.3259 WP_001181004.1.32590 WP_001181004.1.32591 WP_001181004.1.32601 WP_001181004.1.32635 WP_001181004.1.32650 WP_001181004.1.32655 WP_001181004.1.32661 WP_001181004.1.32676 WP_001181004.1.32680 WP_001181004.1.3269 WP_001181004.1.327 WP_001181004.1.32709 WP_001181004.1.32715 WP_001181004.1.32718 WP_001181004.1.32720 WP_001181004.1.32722 WP_001181004.1.32724 WP_001181004.1.32741 WP_001181004.1.32748 WP_001181004.1.32772 WP_001181004.1.32811 WP_001181004.1.32815 WP_001181004.1.32831 WP_001181004.1.32835 WP_001181004.1.32875 WP_001181004.1.32888 WP_001181004.1.32903 WP_001181004.1.32910 WP_001181004.1.32931 WP_001181004.1.32938 WP_001181004.1.32946 WP_001181004.1.3295 WP_001181004.1.32959 WP_001181004.1.32972 WP_001181004.1.32984 WP_001181004.1.32992 WP_001181004.1.32995 WP_001181004.1.33004 WP_001181004.1.33014 WP_001181004.1.33018 WP_001181004.1.33022 WP_001181004.1.33026 WP_001181004.1.33046 WP_001181004.1.33049 WP_001181004.1.33053 WP_001181004.1.33055 WP_001181004.1.33094 WP_001181004.1.33101 WP_001181004.1.33119 WP_001181004.1.33125 WP_001181004.1.33146 WP_001181004.1.33167 WP_001181004.1.33171 WP_001181004.1.33178 WP_001181004.1.33179 WP_001181004.1.33190 WP_001181004.1.33217 WP_001181004.1.33222 WP_001181004.1.3323 WP_001181004.1.33237 WP_001181004.1.33238 WP_001181004.1.33244 WP_001181004.1.33268 WP_001181004.1.33303 WP_001181004.1.33325 WP_001181004.1.33341 WP_001181004.1.33362 WP_001181004.1.33369 WP_001181004.1.33385 WP_001181004.1.334 WP_001181004.1.33408 WP_001181004.1.33410 WP_001181004.1.33413 WP_001181004.1.33422 WP_001181004.1.33424 WP_001181004.1.33428 WP_001181004.1.3344 WP_001181004.1.33475 WP_001181004.1.33476 WP_001181004.1.33502 WP_001181004.1.33512 WP_001181004.1.33525 WP_001181004.1.33526 WP_001181004.1.3354 WP_001181004.1.33545 WP_001181004.1.33561 WP_001181004.1.33563 WP_001181004.1.33565 WP_001181004.1.33584 WP_001181004.1.33595 WP_001181004.1.33631 WP_001181004.1.33638 WP_001181004.1.33648 WP_001181004.1.33667 WP_001181004.1.33680 WP_001181004.1.33729 WP_001181004.1.33736 WP_001181004.1.33745 WP_001181004.1.33746 WP_001181004.1.33751 WP_001181004.1.33780 WP_001181004.1.33799 WP_001181004.1.33823 WP_001181004.1.33853 WP_001181004.1.33854 WP_001181004.1.33879 WP_001181004.1.33888 WP_001181004.1.33896 WP_001181004.1.33905 WP_001181004.1.33914 WP_001181004.1.33948 WP_001181004.1.33952 WP_001181004.1.33973 WP_001181004.1.33974 WP_001181004.1.33979 WP_001181004.1.3398 WP_001181004.1.33981 WP_001181004.1.34003 WP_001181004.1.3401 WP_001181004.1.34032 WP_001181004.1.34094 WP_001181004.1.3411 WP_001181004.1.34117 WP_001181004.1.34121 WP_001181004.1.34122 WP_001181004.1.34124 WP_001181004.1.34130 WP_001181004.1.34144 WP_001181004.1.3415 WP_001181004.1.342 WP_001181004.1.34204 WP_001181004.1.34206 WP_001181004.1.34208 WP_001181004.1.34224 WP_001181004.1.34269 WP_001181004.1.34270 WP_001181004.1.34273 WP_001181004.1.34277 WP_001181004.1.34294 WP_001181004.1.34303 WP_001181004.1.3432 WP_001181004.1.34332 WP_001181004.1.34341 WP_001181004.1.34348 WP_001181004.1.34362 WP_001181004.1.34363 WP_001181004.1.34380 WP_001181004.1.34383 WP_001181004.1.3439 WP_001181004.1.34397 WP_001181004.1.34400 WP_001181004.1.34422 WP_001181004.1.3444 WP_001181004.1.34440 WP_001181004.1.34441 WP_001181004.1.34444 WP_001181004.1.34456 WP_001181004.1.34464 WP_001181004.1.34470 WP_001181004.1.34500 WP_001181004.1.34525 WP_001181004.1.34528 WP_001181004.1.34532 WP_001181004.1.34538 WP_001181004.1.34541 WP_001181004.1.34557 WP_001181004.1.34558 WP_001181004.1.3460 WP_001181004.1.34605 WP_001181004.1.34617 WP_001181004.1.34655 WP_001181004.1.34668 WP_001181004.1.34675 WP_001181004.1.34680 WP_001181004.1.34682 WP_001181004.1.34683 WP_001181004.1.34686 WP_001181004.1.3469 WP_001181004.1.347 WP_001181004.1.3472 WP_001181004.1.34727 WP_001181004.1.34763 WP_001181004.1.34781 WP_001181004.1.34782 WP_001181004.1.34794 WP_001181004.1.34827 WP_001181004.1.34835 WP_001181004.1.34838 WP_001181004.1.34855 WP_001181004.1.34875 WP_001181004.1.34887 WP_001181004.1.34913 WP_001181004.1.34931 WP_001181004.1.34948 WP_001181004.1.34966 WP_001181004.1.34982 WP_001181004.1.34983 WP_001181004.1.34990 WP_001181004.1.34993 WP_001181004.1.35003 WP_001181004.1.35006 WP_001181004.1.35007 WP_001181004.1.35012 WP_001181004.1.35039 WP_001181004.1.35107 WP_001181004.1.35114 WP_001181004.1.35127 WP_001181004.1.35132 WP_001181004.1.3515 WP_001181004.1.35168 WP_001181004.1.35180 WP_001181004.1.35186 WP_001181004.1.35195 WP_001181004.1.35198 WP_001181004.1.35202 WP_001181004.1.35204 WP_001181004.1.35208 WP_001181004.1.3521 WP_001181004.1.35211 WP_001181004.1.35220 WP_001181004.1.35253 WP_001181004.1.35258 WP_001181004.1.35316 WP_001181004.1.35328 WP_001181004.1.35349 WP_001181004.1.35360 WP_001181004.1.35365 WP_001181004.1.35368 WP_001181004.1.35376 WP_001181004.1.3539 WP_001181004.1.35393 WP_001181004.1.35394 WP_001181004.1.35398 WP_001181004.1.35448 WP_001181004.1.35464 WP_001181004.1.35465 WP_001181004.1.35466 WP_001181004.1.35468 WP_001181004.1.35483 WP_001181004.1.3550 WP_001181004.1.35552 WP_001181004.1.35578 WP_001181004.1.35581 WP_001181004.1.3560 WP_001181004.1.35604 WP_001181004.1.35627 WP_001181004.1.35632 WP_001181004.1.35651 WP_001181004.1.35653 WP_001181004.1.35654 WP_001181004.1.35698 WP_001181004.1.35704 WP_001181004.1.35740 WP_001181004.1.35741 WP_001181004.1.35744 WP_001181004.1.35789 WP_001181004.1.35889 WP_001181004.1.35904 WP_001181004.1.35922 WP_001181004.1.35927 WP_001181004.1.35934 WP_001181004.1.35942 WP_001181004.1.35959 WP_001181004.1.35963 WP_001181004.1.3598 WP_001181004.1.35983 WP_001181004.1.35985 WP_001181004.1.35987 WP_001181004.1.35990 WP_001181004.1.3600 WP_001181004.1.36010 WP_001181004.1.36040 WP_001181004.1.36042 WP_001181004.1.36070 WP_001181004.1.36071 WP_001181004.1.36085 WP_001181004.1.36094 WP_001181004.1.36105 WP_001181004.1.36129 WP_001181004.1.36132 WP_001181004.1.36158 WP_001181004.1.36159 WP_001181004.1.36164 WP_001181004.1.36166 WP_001181004.1.36177 WP_001181004.1.36182 WP_001181004.1.3620 WP_001181004.1.36207 WP_001181004.1.36212 WP_001181004.1.3624 WP_001181004.1.36281 WP_001181004.1.36299 WP_001181004.1.36332 WP_001181004.1.36334 WP_001181004.1.36352 WP_001181004.1.36386 WP_001181004.1.36393 WP_001181004.1.36405 WP_001181004.1.36412 WP_001181004.1.36414 WP_001181004.1.36426 WP_001181004.1.3643 WP_001181004.1.36453 WP_001181004.1.36459 WP_001181004.1.36496 WP_001181004.1.365 WP_001181004.1.36500 WP_001181004.1.36507 WP_001181004.1.36523 WP_001181004.1.36531 WP_001181004.1.36537 WP_001181004.1.36545 WP_001181004.1.36610 WP_001181004.1.36626 WP_001181004.1.36627 WP_001181004.1.36628 WP_001181004.1.36667 WP_001181004.1.3668 WP_001181004.1.36699 WP_001181004.1.36707 WP_001181004.1.3671 WP_001181004.1.36724 WP_001181004.1.36739 WP_001181004.1.36746 WP_001181004.1.36747 WP_001181004.1.36761 WP_001181004.1.36767 WP_001181004.1.36786 WP_001181004.1.36799 WP_001181004.1.36806 WP_001181004.1.36812 WP_001181004.1.36817 WP_001181004.1.36826 WP_001181004.1.36833 WP_001181004.1.36856 WP_001181004.1.36886 WP_001181004.1.36894 WP_001181004.1.36904 WP_001181004.1.36925 WP_001181004.1.3697 WP_001181004.1.36971 WP_001181004.1.36975 WP_001181004.1.37006 WP_001181004.1.37020 WP_001181004.1.37032 WP_001181004.1.37046 WP_001181004.1.37049 WP_001181004.1.37057 WP_001181004.1.37076 WP_001181004.1.37099 WP_001181004.1.37101 WP_001181004.1.37102 WP_001181004.1.37103 WP_001181004.1.37122 WP_001181004.1.37146 WP_001181004.1.37153 WP_001181004.1.37155 WP_001181004.1.37206 WP_001181004.1.37226 WP_001181004.1.3723 WP_001181004.1.37233 WP_001181004.1.37252 WP_001181004.1.37261 WP_001181004.1.37266 WP_001181004.1.37290 WP_001181004.1.3730 WP_001181004.1.37306 WP_001181004.1.37312 WP_001181004.1.37313 WP_001181004.1.37329 WP_001181004.1.37334 WP_001181004.1.37337 WP_001181004.1.37342 WP_001181004.1.37352 WP_001181004.1.37360 WP_001181004.1.37371 WP_001181004.1.37372 WP_001181004.1.37388 WP_001181004.1.37419 WP_001181004.1.37423 WP_001181004.1.37433 WP_001181004.1.37445 WP_001181004.1.37472 WP_001181004.1.37476 WP_001181004.1.37477 WP_001181004.1.37485 WP_001181004.1.3749 WP_001181004.1.37510 WP_001181004.1.37516 WP_001181004.1.37538 WP_001181004.1.37543 WP_001181004.1.37544 WP_001181004.1.37548 WP_001181004.1.37549 WP_001181004.1.37550 WP_001181004.1.37554 WP_001181004.1.37576 WP_001181004.1.37588 WP_001181004.1.37592 WP_001181004.1.37608 WP_001181004.1.3762 WP_001181004.1.37634 WP_001181004.1.37637 WP_001181004.1.37664 WP_001181004.1.377 WP_001181004.1.3772 WP_001181004.1.37730 WP_001181004.1.37731 WP_001181004.1.37736 WP_001181004.1.37745 WP_001181004.1.37750 WP_001181004.1.37758 WP_001181004.1.37762 WP_001181004.1.37766 WP_001181004.1.37769 WP_001181004.1.37773 WP_001181004.1.37817 WP_001181004.1.37830 WP_001181004.1.37847 WP_001181004.1.37852 WP_001181004.1.37853 WP_001181004.1.3788 WP_001181004.1.37880 WP_001181004.1.37887 WP_001181004.1.37897 WP_001181004.1.37917 WP_001181004.1.37923 WP_001181004.1.37926 WP_001181004.1.37940 WP_001181004.1.3795 WP_001181004.1.3796 WP_001181004.1.37962 WP_001181004.1.37964 WP_001181004.1.37967 WP_001181004.1.37984 WP_001181004.1.37995 WP_001181004.1.37998 WP_001181004.1.38000 WP_001181004.1.38033 WP_001181004.1.38043 WP_001181004.1.38050 WP_001181004.1.38063 WP_001181004.1.38080 WP_001181004.1.38081 WP_001181004.1.38085 WP_001181004.1.38103 WP_001181004.1.38105 WP_001181004.1.38107 WP_001181004.1.3811 WP_001181004.1.38119 WP_001181004.1.38120 WP_001181004.1.3815 WP_001181004.1.38155 WP_001181004.1.38162 WP_001181004.1.38182 WP_001181004.1.38185 WP_001181004.1.38194 WP_001181004.1.38202 WP_001181004.1.38211 WP_001181004.1.3822 WP_001181004.1.38234 WP_001181004.1.38257 WP_001181004.1.38264 WP_001181004.1.38293 WP_001181004.1.38300 WP_001181004.1.38306 WP_001181004.1.38314 WP_001181004.1.38323 WP_001181004.1.38357 WP_001181004.1.38363 WP_001181004.1.38369 WP_001181004.1.38371 WP_001181004.1.38392 WP_001181004.1.38412 WP_001181004.1.38419 WP_001181004.1.38485 WP_001181004.1.38533 WP_001181004.1.38544 WP_001181004.1.38561 WP_001181004.1.38567 WP_001181004.1.38584 WP_001181004.1.38610 WP_001181004.1.38626 WP_001181004.1.38629 WP_001181004.1.38636 WP_001181004.1.38694 WP_001181004.1.38722 WP_001181004.1.3873 WP_001181004.1.38751 WP_001181004.1.38777 WP_001181004.1.38782 WP_001181004.1.38811 WP_001181004.1.38827 WP_001181004.1.38835 WP_001181004.1.38843 WP_001181004.1.38896 WP_001181004.1.389 WP_001181004.1.38911 WP_001181004.1.38920 WP_001181004.1.38935 WP_001181004.1.38937 WP_001181004.1.38950 WP_001181004.1.38956 WP_001181004.1.38958 WP_001181004.1.39005 WP_001181004.1.39015 WP_001181004.1.3903 WP_001181004.1.39037 WP_001181004.1.3904 WP_001181004.1.39042 WP_001181004.1.39063 WP_001181004.1.39103 WP_001181004.1.39111 WP_001181004.1.3912 WP_001181004.1.39123 WP_001181004.1.39148 WP_001181004.1.39150 WP_001181004.1.39155 WP_001181004.1.39157 WP_001181004.1.39164 WP_001181004.1.39167 WP_001181004.1.39171 WP_001181004.1.39180 WP_001181004.1.39184 WP_001181004.1.39196 WP_001181004.1.39209 WP_001181004.1.3921 WP_001181004.1.3922 WP_001181004.1.39232 WP_001181004.1.39249 WP_001181004.1.39254 WP_001181004.1.39268 WP_001181004.1.39286 WP_001181004.1.39289 WP_001181004.1.39302 WP_001181004.1.39305 WP_001181004.1.39310 WP_001181004.1.39313 WP_001181004.1.39325 WP_001181004.1.39327 WP_001181004.1.39335 WP_001181004.1.39342 WP_001181004.1.39356 WP_001181004.1.39358 WP_001181004.1.39365 WP_001181004.1.39367 WP_001181004.1.39373 WP_001181004.1.39377 WP_001181004.1.39401 WP_001181004.1.39402 WP_001181004.1.39415 WP_001181004.1.39423 WP_001181004.1.39430 WP_001181004.1.39468 WP_001181004.1.39481 WP_001181004.1.39492 WP_001181004.1.39509 WP_001181004.1.39531 WP_001181004.1.3954 WP_001181004.1.39541 WP_001181004.1.39564 WP_001181004.1.39575 WP_001181004.1.39580 WP_001181004.1.39594 WP_001181004.1.39601 WP_001181004.1.39606 WP_001181004.1.39607 WP_001181004.1.39610 WP_001181004.1.39626 WP_001181004.1.39636 WP_001181004.1.39646 WP_001181004.1.39651 WP_001181004.1.39690 WP_001181004.1.3970 WP_001181004.1.39708 WP_001181004.1.39709 WP_001181004.1.39713 WP_001181004.1.39715 WP_001181004.1.39717 WP_001181004.1.39726 WP_001181004.1.39730 WP_001181004.1.39733 WP_001181004.1.39734 WP_001181004.1.39758 WP_001181004.1.39780 WP_001181004.1.39796 WP_001181004.1.3980 WP_001181004.1.39809 WP_001181004.1.39818 WP_001181004.1.39820 WP_001181004.1.39822 WP_001181004.1.39829 WP_001181004.1.39867 WP_001181004.1.39870 WP_001181004.1.39892 WP_001181004.1.39938 WP_001181004.1.39961 WP_001181004.1.39966 WP_001181004.1.39970 WP_001181004.1.39973 WP_001181004.1.39992 WP_001181004.1.39998 WP_001181004.1.40 WP_001181004.1.40013 WP_001181004.1.40016 WP_001181004.1.40019 WP_001181004.1.4005 WP_001181004.1.40083 WP_001181004.1.40088 WP_001181004.1.40107 WP_001181004.1.40113 WP_001181004.1.40121 WP_001181004.1.40140 WP_001181004.1.40147 WP_001181004.1.40153 WP_001181004.1.40159 WP_001181004.1.40183 WP_001181004.1.40190 WP_001181004.1.40192 WP_001181004.1.4020 WP_001181004.1.40206 WP_001181004.1.40211 WP_001181004.1.40212 WP_001181004.1.40218 WP_001181004.1.40234 WP_001181004.1.40238 WP_001181004.1.40249 WP_001181004.1.40298 WP_001181004.1.4030 WP_001181004.1.40300 WP_001181004.1.40315 WP_001181004.1.40317 WP_001181004.1.40319 WP_001181004.1.40335 WP_001181004.1.40345 WP_001181004.1.40349 WP_001181004.1.40360 WP_001181004.1.40382 WP_001181004.1.40389 WP_001181004.1.40391 WP_001181004.1.40403 WP_001181004.1.40445 WP_001181004.1.40486 WP_001181004.1.4049 WP_001181004.1.40499 WP_001181004.1.40502 WP_001181004.1.40509 WP_001181004.1.40524 WP_001181004.1.40539 WP_001181004.1.40548 WP_001181004.1.40549 WP_001181004.1.40560 WP_001181004.1.40563 WP_001181004.1.40596 WP_001181004.1.40599 WP_001181004.1.406 WP_001181004.1.40607 WP_001181004.1.40617 WP_001181004.1.40623 WP_001181004.1.40629 WP_001181004.1.40636 WP_001181004.1.40657 WP_001181004.1.40660 WP_001181004.1.40666 WP_001181004.1.40668 WP_001181004.1.40686 WP_001181004.1.40712 WP_001181004.1.40715 WP_001181004.1.40742 WP_001181004.1.40758 WP_001181004.1.40781 WP_001181004.1.40793 WP_001181004.1.4081 WP_001181004.1.40813 WP_001181004.1.40815 WP_001181004.1.40833 WP_001181004.1.40842 WP_001181004.1.40843 WP_001181004.1.40865 WP_001181004.1.40882 WP_001181004.1.40893 WP_001181004.1.40898 WP_001181004.1.40900 WP_001181004.1.40912 WP_001181004.1.40937 WP_001181004.1.40952 WP_001181004.1.40965 WP_001181004.1.4103 WP_001181004.1.41037 WP_001181004.1.41041 WP_001181004.1.41045 WP_001181004.1.41060 WP_001181004.1.41063 WP_001181004.1.41078 WP_001181004.1.41113 WP_001181004.1.41125 WP_001181004.1.41147 WP_001181004.1.41206 WP_001181004.1.4122 WP_001181004.1.41230 WP_001181004.1.41239 WP_001181004.1.41244 WP_001181004.1.41259 WP_001181004.1.4126 WP_001181004.1.41263 WP_001181004.1.41271 WP_001181004.1.41287 WP_001181004.1.41294 WP_001181004.1.41315 WP_001181004.1.41330 WP_001181004.1.41332 WP_001181004.1.41339 WP_001181004.1.41346 WP_001181004.1.41363 WP_001181004.1.41368 WP_001181004.1.41371 WP_001181004.1.41372 WP_001181004.1.41391 WP_001181004.1.41392 WP_001181004.1.41394 WP_001181004.1.41401 WP_001181004.1.41402 WP_001181004.1.41407 WP_001181004.1.41417 WP_001181004.1.4142 WP_001181004.1.41436 WP_001181004.1.41449 WP_001181004.1.41453 WP_001181004.1.41455 WP_001181004.1.41457 WP_001181004.1.41466 WP_001181004.1.41478 WP_001181004.1.41479 WP_001181004.1.41481 WP_001181004.1.41482 WP_001181004.1.41483 WP_001181004.1.41484 WP_001181004.1.41488 WP_001181004.1.41530 WP_001181004.1.41536 WP_001181004.1.41539 WP_001181004.1.41545 WP_001181004.1.41556 WP_001181004.1.41566 WP_001181004.1.4158 WP_001181004.1.41606 WP_001181004.1.41613 WP_001181004.1.41621 WP_001181004.1.41651 WP_001181004.1.41654 WP_001181004.1.41712 WP_001181004.1.41718 WP_001181004.1.4172 WP_001181004.1.41734 WP_001181004.1.41740 WP_001181004.1.41741 WP_001181004.1.41752 WP_001181004.1.41778 WP_001181004.1.41780 WP_001181004.1.41782 WP_001181004.1.41783 WP_001181004.1.41784 WP_001181004.1.41809 WP_001181004.1.41812 WP_001181004.1.41813 WP_001181004.1.41822 WP_001181004.1.41826 WP_001181004.1.41837 WP_001181004.1.41847 WP_001181004.1.41849 WP_001181004.1.41884 WP_001181004.1.41885 WP_001181004.1.4189 WP_001181004.1.41900 WP_001181004.1.41923 WP_001181004.1.41956 WP_001181004.1.41960 WP_001181004.1.41964 WP_001181004.1.41988 WP_001181004.1.41990 WP_001181004.1.41991 WP_001181004.1.42022 WP_001181004.1.42027 WP_001181004.1.42033 WP_001181004.1.42036 WP_001181004.1.42038 WP_001181004.1.42044 WP_001181004.1.42073 WP_001181004.1.42095 WP_001181004.1.42096 WP_001181004.1.42113 WP_001181004.1.4213 WP_001181004.1.42138 WP_001181004.1.4214 WP_001181004.1.42151 WP_001181004.1.42159 WP_001181004.1.42179 WP_001181004.1.42191 WP_001181004.1.42203 WP_001181004.1.42209 WP_001181004.1.42214 WP_001181004.1.42221 WP_001181004.1.42226 WP_001181004.1.42228 WP_001181004.1.42233 WP_001181004.1.4224 WP_001181004.1.42252 WP_001181004.1.42258 WP_001181004.1.42277 WP_001181004.1.42284 WP_001181004.1.42300 WP_001181004.1.42318 WP_001181004.1.42350 WP_001181004.1.42359 WP_001181004.1.42367 WP_001181004.1.42369 WP_001181004.1.42376 WP_001181004.1.42387 WP_001181004.1.42413 WP_001181004.1.42415 WP_001181004.1.4242 WP_001181004.1.42432 WP_001181004.1.42442 WP_001181004.1.42443 WP_001181004.1.42447 WP_001181004.1.42448 WP_001181004.1.42456 WP_001181004.1.42480 WP_001181004.1.4250 WP_001181004.1.42513 WP_001181004.1.42516 WP_001181004.1.42522 WP_001181004.1.42547 WP_001181004.1.42586 WP_001181004.1.42594 WP_001181004.1.42597 WP_001181004.1.42600 WP_001181004.1.42601 WP_001181004.1.4261 WP_001181004.1.42632 WP_001181004.1.42638 WP_001181004.1.42661 WP_001181004.1.42669 WP_001181004.1.42670 WP_001181004.1.42677 WP_001181004.1.42709 WP_001181004.1.42728 WP_001181004.1.42748 WP_001181004.1.42749 WP_001181004.1.42750 WP_001181004.1.42756 WP_001181004.1.42761 WP_001181004.1.42770 WP_001181004.1.42771 WP_001181004.1.42791 WP_001181004.1.42804 WP_001181004.1.42808 WP_001181004.1.42813 WP_001181004.1.4282 WP_001181004.1.42828 WP_001181004.1.42830 WP_001181004.1.42832 WP_001181004.1.42863 WP_001181004.1.42879 WP_001181004.1.42891 WP_001181004.1.4290 WP_001181004.1.42903 WP_001181004.1.42918 WP_001181004.1.42936 WP_001181004.1.42937 WP_001181004.1.42950 WP_001181004.1.42962 WP_001181004.1.42966 WP_001181004.1.42970 WP_001181004.1.42975 WP_001181004.1.42987 WP_001181004.1.42989 WP_001181004.1.42991 WP_001181004.1.43013 WP_001181004.1.43027 WP_001181004.1.43035 WP_001181004.1.4306 WP_001181004.1.43079 WP_001181004.1.43121 WP_001181004.1.43123 WP_001181004.1.4313 WP_001181004.1.43132 WP_001181004.1.43133 WP_001181004.1.43137 WP_001181004.1.43140 WP_001181004.1.43166 WP_001181004.1.43170 WP_001181004.1.43174 WP_001181004.1.43177 WP_001181004.1.43196 WP_001181004.1.43213 WP_001181004.1.43216 WP_001181004.1.43239 WP_001181004.1.43270 WP_001181004.1.43278 WP_001181004.1.43316 WP_001181004.1.43324 WP_001181004.1.4334 WP_001181004.1.43363 WP_001181004.1.43374 WP_001181004.1.43384 WP_001181004.1.43389 WP_001181004.1.4342 WP_001181004.1.43422 WP_001181004.1.43427 WP_001181004.1.4343 WP_001181004.1.43444 WP_001181004.1.43448 WP_001181004.1.43455 WP_001181004.1.43469 WP_001181004.1.43473 WP_001181004.1.43474 WP_001181004.1.43489 WP_001181004.1.43501 WP_001181004.1.43536 WP_001181004.1.4356 WP_001181004.1.43561 WP_001181004.1.43566 WP_001181004.1.43598 WP_001181004.1.436 WP_001181004.1.43604 WP_001181004.1.43622 WP_001181004.1.43642 WP_001181004.1.43720 WP_001181004.1.43733 WP_001181004.1.43738 WP_001181004.1.43750 WP_001181004.1.43754 WP_001181004.1.43769 WP_001181004.1.43798 WP_001181004.1.43803 WP_001181004.1.43804 WP_001181004.1.43816 WP_001181004.1.43837 WP_001181004.1.43858 WP_001181004.1.43868 WP_001181004.1.43898 WP_001181004.1.43911 WP_001181004.1.43918 WP_001181004.1.43925 WP_001181004.1.43939 WP_001181004.1.43942 WP_001181004.1.43953 WP_001181004.1.43966 WP_001181004.1.43989 WP_001181004.1.440 WP_001181004.1.4400 WP_001181004.1.44018 WP_001181004.1.44020 WP_001181004.1.44029 WP_001181004.1.44040 WP_001181004.1.44051 WP_001181004.1.44075 WP_001181004.1.44077 WP_001181004.1.44088 WP_001181004.1.44096 WP_001181004.1.44100 WP_001181004.1.4411 WP_001181004.1.44115 WP_001181004.1.44125 WP_001181004.1.44130 WP_001181004.1.44133 WP_001181004.1.4415 WP_001181004.1.44162 WP_001181004.1.44165 WP_001181004.1.44166 WP_001181004.1.44201 WP_001181004.1.44203 WP_001181004.1.44211 WP_001181004.1.44222 WP_001181004.1.44238 WP_001181004.1.44251 WP_001181004.1.44263 WP_001181004.1.44264 WP_001181004.1.44273 WP_001181004.1.44285 WP_001181004.1.44287 WP_001181004.1.44314 WP_001181004.1.44324 WP_001181004.1.44327 WP_001181004.1.44354 WP_001181004.1.44365 WP_001181004.1.44389 WP_001181004.1.44394 WP_001181004.1.44422 WP_001181004.1.44424 WP_001181004.1.44426 WP_001181004.1.44445 WP_001181004.1.44447 WP_001181004.1.4445 WP_001181004.1.44452 WP_001181004.1.44458 WP_001181004.1.44460 WP_001181004.1.44461 WP_001181004.1.44488 WP_001181004.1.4449 WP_001181004.1.44524 WP_001181004.1.44539 WP_001181004.1.4454 WP_001181004.1.44558 WP_001181004.1.44561 WP_001181004.1.44570 WP_001181004.1.44587 WP_001181004.1.4459 WP_001181004.1.44608 WP_001181004.1.44610 WP_001181004.1.44622 WP_001181004.1.44627 WP_001181004.1.4463 WP_001181004.1.44642 WP_001181004.1.44649 WP_001181004.1.44661 WP_001181004.1.44668 WP_001181004.1.44671 WP_001181004.1.44686 WP_001181004.1.4471 WP_001181004.1.44717 WP_001181004.1.44724 WP_001181004.1.4473 WP_001181004.1.44733 WP_001181004.1.44756 WP_001181004.1.44759 WP_001181004.1.44784 WP_001181004.1.448 WP_001181004.1.44800 WP_001181004.1.44814 WP_001181004.1.44818 WP_001181004.1.44821 WP_001181004.1.44836 WP_001181004.1.44840 WP_001181004.1.44841 WP_001181004.1.44843 WP_001181004.1.44848 WP_001181004.1.44849 WP_001181004.1.44854 WP_001181004.1.44855 WP_001181004.1.44857 WP_001181004.1.44906 WP_001181004.1.44923 WP_001181004.1.44954 WP_001181004.1.44960 WP_001181004.1.44961 WP_001181004.1.44970 WP_001181004.1.44975 WP_001181004.1.44977 WP_001181004.1.44980 WP_001181004.1.45000 WP_001181004.1.45020 WP_001181004.1.45025 WP_001181004.1.45028 WP_001181004.1.45043 WP_001181004.1.45053 WP_001181004.1.45068 WP_001181004.1.45076 WP_001181004.1.45104 WP_001181004.1.45116 WP_001181004.1.4515 WP_001181004.1.45153 WP_001181004.1.45156 WP_001181004.1.4516 WP_001181004.1.45190 WP_001181004.1.45195 WP_001181004.1.45208 WP_001181004.1.4524 WP_001181004.1.45246 WP_001181004.1.45293 WP_001181004.1.4530 WP_001181004.1.45313 WP_001181004.1.45329 WP_001181004.1.4535 WP_001181004.1.45359 WP_001181004.1.4538 WP_001181004.1.45392 WP_001181004.1.45404 WP_001181004.1.45405 WP_001181004.1.4541 WP_001181004.1.45440 WP_001181004.1.45444 WP_001181004.1.45486 WP_001181004.1.4549 WP_001181004.1.45494 WP_001181004.1.45500 WP_001181004.1.45525 WP_001181004.1.45536 WP_001181004.1.45538 WP_001181004.1.45565 WP_001181004.1.45575 WP_001181004.1.45581 WP_001181004.1.45595 WP_001181004.1.45600 WP_001181004.1.45627 WP_001181004.1.4563 WP_001181004.1.45664 WP_001181004.1.45674 WP_001181004.1.45676 WP_001181004.1.4570 WP_001181004.1.45707 WP_001181004.1.45718 WP_001181004.1.4574 WP_001181004.1.45740 WP_001181004.1.45741 WP_001181004.1.45752 WP_001181004.1.4576 WP_001181004.1.45789 WP_001181004.1.45793 WP_001181004.1.45799 WP_001181004.1.45801 WP_001181004.1.45806 WP_001181004.1.4583 WP_001181004.1.45840 WP_001181004.1.45841 WP_001181004.1.45846 WP_001181004.1.45865 WP_001181004.1.45868 WP_001181004.1.45891 WP_001181004.1.45901 WP_001181004.1.45921 WP_001181004.1.4593 WP_001181004.1.45930 WP_001181004.1.45931 WP_001181004.1.45933 WP_001181004.1.45941 WP_001181004.1.45945 WP_001181004.1.45949 WP_001181004.1.45960 WP_001181004.1.45962 WP_001181004.1.45968 WP_001181004.1.45990 WP_001181004.1.45991 WP_001181004.1.4600 WP_001181004.1.46016 WP_001181004.1.46026 WP_001181004.1.46027 WP_001181004.1.46039 WP_001181004.1.46048 WP_001181004.1.46049 WP_001181004.1.46070 WP_001181004.1.46081 WP_001181004.1.46097 WP_001181004.1.4610 WP_001181004.1.46105 WP_001181004.1.46115 WP_001181004.1.46122 WP_001181004.1.4613 WP_001181004.1.46164 WP_001181004.1.4617 WP_001181004.1.46186 WP_001181004.1.4619 WP_001181004.1.46197 WP_001181004.1.46213 WP_001181004.1.46217 WP_001181004.1.46239 WP_001181004.1.46245 WP_001181004.1.46257 WP_001181004.1.46263 WP_001181004.1.46282 WP_001181004.1.46283 WP_001181004.1.46291 WP_001181004.1.46301 WP_001181004.1.46325 WP_001181004.1.46329 WP_001181004.1.46369 WP_001181004.1.46378 WP_001181004.1.46379 WP_001181004.1.46414 WP_001181004.1.4643 WP_001181004.1.46433 WP_001181004.1.46438 WP_001181004.1.46441 WP_001181004.1.46451 WP_001181004.1.4646 WP_001181004.1.46468 WP_001181004.1.4647 WP_001181004.1.46477 WP_001181004.1.46487 WP_001181004.1.46503 WP_001181004.1.46526 WP_001181004.1.46531 WP_001181004.1.46541 WP_001181004.1.46552 WP_001181004.1.46555 WP_001181004.1.4657 WP_001181004.1.46573 WP_001181004.1.46582 WP_001181004.1.46589 WP_001181004.1.46594 WP_001181004.1.46602 WP_001181004.1.46611 WP_001181004.1.46614 WP_001181004.1.46616 WP_001181004.1.46626 WP_001181004.1.46643 WP_001181004.1.46655 WP_001181004.1.46668 WP_001181004.1.4670 WP_001181004.1.46734 WP_001181004.1.46743 WP_001181004.1.46795 WP_001181004.1.46798 WP_001181004.1.46802 WP_001181004.1.46806 WP_001181004.1.46810 WP_001181004.1.46820 WP_001181004.1.46821 WP_001181004.1.46832 WP_001181004.1.46833 WP_001181004.1.46841 WP_001181004.1.46857 WP_001181004.1.46860 WP_001181004.1.46876 WP_001181004.1.46882 WP_001181004.1.46898 WP_001181004.1.46909 WP_001181004.1.4691 WP_001181004.1.46912 WP_001181004.1.46913 WP_001181004.1.46932 WP_001181004.1.4695 WP_001181004.1.46990 WP_001181004.1.46991 WP_001181004.1.46994 WP_001181004.1.46999 WP_001181004.1.47024 WP_001181004.1.47028 WP_001181004.1.47029 WP_001181004.1.47030 WP_001181004.1.47034 WP_001181004.1.47038 WP_001181004.1.47039 WP_001181004.1.47047 WP_001181004.1.47048 WP_001181004.1.47050 WP_001181004.1.47054 WP_001181004.1.47063 WP_001181004.1.47069 WP_001181004.1.47073 WP_001181004.1.4708 WP_001181004.1.47124 WP_001181004.1.47135 WP_001181004.1.47140 WP_001181004.1.47156 WP_001181004.1.47167 WP_001181004.1.47171 WP_001181004.1.47186 WP_001181004.1.47189 WP_001181004.1.47197 WP_001181004.1.47198 WP_001181004.1.4722 WP_001181004.1.47224 WP_001181004.1.4723 WP_001181004.1.47235 WP_001181004.1.47246 WP_001181004.1.47247 WP_001181004.1.4725 WP_001181004.1.47280 WP_001181004.1.47307 WP_001181004.1.47316 WP_001181004.1.47319 WP_001181004.1.47322 WP_001181004.1.47332 WP_001181004.1.47344 WP_001181004.1.47349 WP_001181004.1.47350 WP_001181004.1.47356 WP_001181004.1.47363 WP_001181004.1.47366 WP_001181004.1.47370 WP_001181004.1.47386 WP_001181004.1.47398 WP_001181004.1.4740 WP_001181004.1.47401 WP_001181004.1.47411 WP_001181004.1.47414 WP_001181004.1.47416 WP_001181004.1.47425 WP_001181004.1.4743 WP_001181004.1.47451 WP_001181004.1.47454 WP_001181004.1.47464 WP_001181004.1.47473 WP_001181004.1.47488 WP_001181004.1.47496 WP_001181004.1.47498 WP_001181004.1.47500 WP_001181004.1.47529 WP_001181004.1.47533 WP_001181004.1.47546 WP_001181004.1.47555 WP_001181004.1.47582 WP_001181004.1.47599 WP_001181004.1.47634 WP_001181004.1.47646 WP_001181004.1.47647 WP_001181004.1.47654 WP_001181004.1.47662 WP_001181004.1.47673 WP_001181004.1.47709 WP_001181004.1.4772 WP_001181004.1.47722 WP_001181004.1.4773 WP_001181004.1.47734 WP_001181004.1.47740 WP_001181004.1.47744 WP_001181004.1.47761 WP_001181004.1.47764 WP_001181004.1.47765 WP_001181004.1.47770 WP_001181004.1.47775 WP_001181004.1.47784 WP_001181004.1.47790 WP_001181004.1.47791 WP_001181004.1.47820 WP_001181004.1.47827 WP_001181004.1.4783 WP_001181004.1.47837 WP_001181004.1.47848 WP_001181004.1.4785 WP_001181004.1.47884 WP_001181004.1.47914 WP_001181004.1.47935 WP_001181004.1.47954 WP_001181004.1.4796 WP_001181004.1.47962 WP_001181004.1.47976 WP_001181004.1.47981 WP_001181004.1.47983 WP_001181004.1.47994 WP_001181004.1.48000 WP_001181004.1.48018 WP_001181004.1.48029 WP_001181004.1.48040 WP_001181004.1.48048 WP_001181004.1.48051 WP_001181004.1.48065 WP_001181004.1.48073 WP_001181004.1.48077 WP_001181004.1.48080 WP_001181004.1.48087 WP_001181004.1.48090 WP_001181004.1.48096 WP_001181004.1.4811 WP_001181004.1.48111 WP_001181004.1.4812 WP_001181004.1.48121 WP_001181004.1.48144 WP_001181004.1.48168 WP_001181004.1.48176 WP_001181004.1.48188 WP_001181004.1.48194 WP_001181004.1.48203 WP_001181004.1.48216 WP_001181004.1.48222 WP_001181004.1.48226 WP_001181004.1.48229 WP_001181004.1.48258 WP_001181004.1.4826 WP_001181004.1.48265 WP_001181004.1.48285 WP_001181004.1.48290 WP_001181004.1.48291 WP_001181004.1.48317 WP_001181004.1.48353 WP_001181004.1.48355 WP_001181004.1.48371 WP_001181004.1.48385 WP_001181004.1.48404 WP_001181004.1.48417 WP_001181004.1.48421 WP_001181004.1.48431 WP_001181004.1.48433 WP_001181004.1.48469 WP_001181004.1.48477 WP_001181004.1.48480 WP_001181004.1.48483 WP_001181004.1.48505 WP_001181004.1.48522 WP_001181004.1.4857 WP_001181004.1.48571 WP_001181004.1.48590 WP_001181004.1.486 WP_001181004.1.48602 WP_001181004.1.48615 WP_001181004.1.48620 WP_001181004.1.48626 WP_001181004.1.48629 WP_001181004.1.48678 WP_001181004.1.48689 WP_001181004.1.48697 WP_001181004.1.4871 WP_001181004.1.48712 WP_001181004.1.4876 WP_001181004.1.48771 WP_001181004.1.48792 WP_001181004.1.48801 WP_001181004.1.48806 WP_001181004.1.48808 WP_001181004.1.48825 WP_001181004.1.48827 WP_001181004.1.48847 WP_001181004.1.48860 WP_001181004.1.48901 WP_001181004.1.48902 WP_001181004.1.48907 WP_001181004.1.48910 WP_001181004.1.4892 WP_001181004.1.48921 WP_001181004.1.48926 WP_001181004.1.48928 WP_001181004.1.48953 WP_001181004.1.48954 WP_001181004.1.48970 WP_001181004.1.48974 WP_001181004.1.49001 WP_001181004.1.49009 WP_001181004.1.49061 WP_001181004.1.49076 WP_001181004.1.49104 WP_001181004.1.49107 WP_001181004.1.49124 WP_001181004.1.49136 WP_001181004.1.49141 WP_001181004.1.49147 WP_001181004.1.49170 WP_001181004.1.49179 WP_001181004.1.49190 WP_001181004.1.49229 WP_001181004.1.49236 WP_001181004.1.49243 WP_001181004.1.49258 WP_001181004.1.49259 WP_001181004.1.49275 WP_001181004.1.4931 WP_001181004.1.49312 WP_001181004.1.49321 WP_001181004.1.49332 WP_001181004.1.49336 WP_001181004.1.49338 WP_001181004.1.49342 WP_001181004.1.49347 WP_001181004.1.49363 WP_001181004.1.49376 WP_001181004.1.49401 WP_001181004.1.49412 WP_001181004.1.49431 WP_001181004.1.49446 WP_001181004.1.49459 WP_001181004.1.49464 WP_001181004.1.49481 WP_001181004.1.49482 WP_001181004.1.49483 WP_001181004.1.4949 WP_001181004.1.49496 WP_001181004.1.49521 WP_001181004.1.49522 WP_001181004.1.49528 WP_001181004.1.4953 WP_001181004.1.49531 WP_001181004.1.49537 WP_001181004.1.49546 WP_001181004.1.49558 WP_001181004.1.49567 WP_001181004.1.49594 WP_001181004.1.49599 WP_001181004.1.49615 WP_001181004.1.49621 WP_001181004.1.49625 WP_001181004.1.49645 WP_001181004.1.49655 WP_001181004.1.49661 WP_001181004.1.49662 WP_001181004.1.49675 WP_001181004.1.49684 WP_001181004.1.497 WP_001181004.1.49712 WP_001181004.1.49722 WP_001181004.1.49733 WP_001181004.1.49740 WP_001181004.1.49768 WP_001181004.1.49771 WP_001181004.1.49774 WP_001181004.1.49777 WP_001181004.1.49783 WP_001181004.1.49788 WP_001181004.1.49794 WP_001181004.1.49820 WP_001181004.1.49823 WP_001181004.1.4985 WP_001181004.1.49856 WP_001181004.1.49861 WP_001181004.1.49879 WP_001181004.1.49883 WP_001181004.1.49884 WP_001181004.1.49900 WP_001181004.1.49902 WP_001181004.1.49941 WP_001181004.1.49950 WP_001181004.1.49954 WP_001181004.1.49972 WP_001181004.1.49987 WP_001181004.1.50006 WP_001181004.1.50008 WP_001181004.1.5003 WP_001181004.1.50036 WP_001181004.1.50056 WP_001181004.1.50058 WP_001181004.1.50078 WP_001181004.1.50098 WP_001181004.1.50110 WP_001181004.1.50113 WP_001181004.1.50119 WP_001181004.1.50136 WP_001181004.1.50146 WP_001181004.1.5017 WP_001181004.1.50179 WP_001181004.1.50182 WP_001181004.1.50187 WP_001181004.1.50191 WP_001181004.1.50196 WP_001181004.1.50207 WP_001181004.1.50214 WP_001181004.1.50228 WP_001181004.1.50230 WP_001181004.1.50258 WP_001181004.1.50262 WP_001181004.1.50266 WP_001181004.1.50269 WP_001181004.1.50270 WP_001181004.1.50273 WP_001181004.1.50278 WP_001181004.1.50304 WP_001181004.1.50329 WP_001181004.1.50345 WP_001181004.1.50353 WP_001181004.1.50358 WP_001181004.1.50361 WP_001181004.1.50366 WP_001181004.1.5037 WP_001181004.1.50380 WP_001181004.1.50381 WP_001181004.1.5040 WP_001181004.1.5041 WP_001181004.1.50412 WP_001181004.1.50418 WP_001181004.1.50427 WP_001181004.1.50446 WP_001181004.1.50452 WP_001181004.1.5046 WP_001181004.1.50539 WP_001181004.1.50548 WP_001181004.1.50549 WP_001181004.1.5056 WP_001181004.1.50564 WP_001181004.1.50579 WP_001181004.1.50585 WP_001181004.1.50586 WP_001181004.1.506 WP_001181004.1.50608 WP_001181004.1.5061 WP_001181004.1.50616 WP_001181004.1.50627 WP_001181004.1.5064 WP_001181004.1.5067 WP_001181004.1.50690 WP_001181004.1.50700 WP_001181004.1.50715 WP_001181004.1.50717 WP_001181004.1.50725 WP_001181004.1.50728 WP_001181004.1.50762 WP_001181004.1.50887 WP_001181004.1.50925 WP_001181004.1.50936 WP_001181004.1.50939 WP_001181004.1.50947 WP_001181004.1.5095 WP_001181004.1.50957 WP_001181004.1.50969 WP_001181004.1.50986 WP_001181004.1.50988 WP_001181004.1.50990 WP_001181004.1.50993 WP_001181004.1.50996 WP_001181004.1.51013 WP_001181004.1.51027 WP_001181004.1.51042 WP_001181004.1.51058 WP_001181004.1.5106 WP_001181004.1.511 WP_001181004.1.51109 WP_001181004.1.51127 WP_001181004.1.51154 WP_001181004.1.51170 WP_001181004.1.51171 WP_001181004.1.51172 WP_001181004.1.51175 WP_001181004.1.51180 WP_001181004.1.51190 WP_001181004.1.51201 WP_001181004.1.51203 WP_001181004.1.51206 WP_001181004.1.51211 WP_001181004.1.5124 WP_001181004.1.51248 WP_001181004.1.51253 WP_001181004.1.51255 WP_001181004.1.51260 WP_001181004.1.51278 WP_001181004.1.5128 WP_001181004.1.51283 WP_001181004.1.51299 WP_001181004.1.51300 WP_001181004.1.51307 WP_001181004.1.51320 WP_001181004.1.51323 WP_001181004.1.51325 WP_001181004.1.51330 WP_001181004.1.51336 WP_001181004.1.51354 WP_001181004.1.51360 WP_001181004.1.51364 WP_001181004.1.51380 WP_001181004.1.51392 WP_001181004.1.51405 WP_001181004.1.51425 WP_001181004.1.51426 WP_001181004.1.51427 WP_001181004.1.51430 WP_001181004.1.51441 WP_001181004.1.5146 WP_001181004.1.51462 WP_001181004.1.51482 WP_001181004.1.51490 WP_001181004.1.51495 WP_001181004.1.51503 WP_001181004.1.51505 WP_001181004.1.51513 WP_001181004.1.51525 WP_001181004.1.5153 WP_001181004.1.51537 WP_001181004.1.51539 WP_001181004.1.51542 WP_001181004.1.51548 WP_001181004.1.51552 WP_001181004.1.5157 WP_001181004.1.5158 WP_001181004.1.51580 WP_001181004.1.51587 WP_001181004.1.51596 WP_001181004.1.51600 WP_001181004.1.51607 WP_001181004.1.51624 WP_001181004.1.51629 WP_001181004.1.51643 WP_001181004.1.51662 WP_001181004.1.51690 WP_001181004.1.51693 WP_001181004.1.51707 WP_001181004.1.51718 WP_001181004.1.5172 WP_001181004.1.51736 WP_001181004.1.51757 WP_001181004.1.51760 WP_001181004.1.51784 WP_001181004.1.518 WP_001181004.1.51804 WP_001181004.1.51834 WP_001181004.1.51837 WP_001181004.1.51839 WP_001181004.1.51869 WP_001181004.1.51873 WP_001181004.1.51881 WP_001181004.1.51896 WP_001181004.1.51899 WP_001181004.1.51906 WP_001181004.1.51944 WP_001181004.1.51949 WP_001181004.1.51968 WP_001181004.1.51979 WP_001181004.1.51985 WP_001181004.1.51988 WP_001181004.1.5199 WP_001181004.1.51999 WP_001181004.1.52002 WP_001181004.1.52011 WP_001181004.1.52020 WP_001181004.1.52039 WP_001181004.1.52044 WP_001181004.1.52048 WP_001181004.1.52062 WP_001181004.1.52076 WP_001181004.1.52085 WP_001181004.1.52098 WP_001181004.1.52111 WP_001181004.1.52126 WP_001181004.1.52127 WP_001181004.1.52135 WP_001181004.1.52137 WP_001181004.1.5217 WP_001181004.1.52171 WP_001181004.1.52186 WP_001181004.1.52200 WP_001181004.1.52211 WP_001181004.1.52213 WP_001181004.1.52214 WP_001181004.1.52225 WP_001181004.1.52230 WP_001181004.1.52236 WP_001181004.1.52240 WP_001181004.1.52243 WP_001181004.1.52249 WP_001181004.1.52257 WP_001181004.1.52258 WP_001181004.1.5227 WP_001181004.1.52270 WP_001181004.1.52271 WP_001181004.1.52272 WP_001181004.1.52299 WP_001181004.1.52304 WP_001181004.1.52305 WP_001181004.1.52313 WP_001181004.1.52324 WP_001181004.1.52328 WP_001181004.1.52333 WP_001181004.1.52363 WP_001181004.1.52378 WP_001181004.1.5239 WP_001181004.1.52399 WP_001181004.1.52406 WP_001181004.1.52413 WP_001181004.1.52419 WP_001181004.1.52421 WP_001181004.1.52492 WP_001181004.1.52496 WP_001181004.1.52524 WP_001181004.1.52542 WP_001181004.1.52543 WP_001181004.1.52544 WP_001181004.1.52554 WP_001181004.1.52558 WP_001181004.1.52567 WP_001181004.1.52568 WP_001181004.1.52601 WP_001181004.1.52612 WP_001181004.1.52631 WP_001181004.1.5265 WP_001181004.1.52662 WP_001181004.1.52691 WP_001181004.1.52704 WP_001181004.1.52710 WP_001181004.1.5272 WP_001181004.1.52735 WP_001181004.1.52755 WP_001181004.1.52762 WP_001181004.1.52771 WP_001181004.1.52774 WP_001181004.1.52777 WP_001181004.1.52780 WP_001181004.1.52781 WP_001181004.1.52801 WP_001181004.1.52804 WP_001181004.1.52844 WP_001181004.1.52846 WP_001181004.1.5285 WP_001181004.1.52852 WP_001181004.1.52853 WP_001181004.1.52855 WP_001181004.1.52881 WP_001181004.1.52883 WP_001181004.1.52895 WP_001181004.1.52908 WP_001181004.1.5291 WP_001181004.1.52913 WP_001181004.1.52933 WP_001181004.1.52942 WP_001181004.1.52945 WP_001181004.1.52962 WP_001181004.1.52995 WP_001181004.1.52996 WP_001181004.1.53012 WP_001181004.1.53020 WP_001181004.1.53021 WP_001181004.1.53027 WP_001181004.1.53065 WP_001181004.1.53084 WP_001181004.1.53095 WP_001181004.1.53099 WP_001181004.1.5310 WP_001181004.1.53110 WP_001181004.1.53123 WP_001181004.1.53155 WP_001181004.1.53162 WP_001181004.1.53181 WP_001181004.1.53186 WP_001181004.1.532 WP_001181004.1.53211 WP_001181004.1.5322 WP_001181004.1.53223 WP_001181004.1.53228 WP_001181004.1.53238 WP_001181004.1.53242 WP_001181004.1.53244 WP_001181004.1.53251 WP_001181004.1.53252 WP_001181004.1.53262 WP_001181004.1.53270 WP_001181004.1.53277 WP_001181004.1.53308 WP_001181004.1.53327 WP_001181004.1.53356 WP_001181004.1.53360 WP_001181004.1.53364 WP_001181004.1.53377 WP_001181004.1.53401 WP_001181004.1.53410 WP_001181004.1.53415 WP_001181004.1.53419 WP_001181004.1.5342 WP_001181004.1.53428 WP_001181004.1.53431 WP_001181004.1.53482 WP_001181004.1.53505 WP_001181004.1.5351 WP_001181004.1.53535 WP_001181004.1.53537 WP_001181004.1.53545 WP_001181004.1.53556 WP_001181004.1.53557 WP_001181004.1.53574 WP_001181004.1.53582 WP_001181004.1.53587 WP_001181004.1.53589 WP_001181004.1.53590 WP_001181004.1.53592 WP_001181004.1.53594 WP_001181004.1.5362 WP_001181004.1.53642 WP_001181004.1.53645 WP_001181004.1.53649 WP_001181004.1.53687 WP_001181004.1.53690 WP_001181004.1.53693 WP_001181004.1.53706 WP_001181004.1.53769 WP_001181004.1.53809 WP_001181004.1.53810 WP_001181004.1.53811 WP_001181004.1.53841 WP_001181004.1.53845 WP_001181004.1.53863 WP_001181004.1.53866 WP_001181004.1.53878 WP_001181004.1.53884 WP_001181004.1.5391 WP_001181004.1.5393 WP_001181004.1.53931 WP_001181004.1.53940 WP_001181004.1.5395 WP_001181004.1.53966 WP_001181004.1.53968 WP_001181004.1.53972 WP_001181004.1.53978 WP_001181004.1.53991 WP_001181004.1.53994 WP_001181004.1.54002 WP_001181004.1.54013 WP_001181004.1.54023 WP_001181004.1.54024 WP_001181004.1.54028 WP_001181004.1.54032 WP_001181004.1.54051 WP_001181004.1.54072 WP_001181004.1.54091 WP_001181004.1.54095 WP_001181004.1.54102 WP_001181004.1.54104 WP_001181004.1.54144 WP_001181004.1.54169 WP_001181004.1.54185 WP_001181004.1.54188 WP_001181004.1.54202 WP_001181004.1.54208 WP_001181004.1.54213 WP_001181004.1.54263 WP_001181004.1.54307 WP_001181004.1.54313 WP_001181004.1.54317 WP_001181004.1.54328 WP_001181004.1.54329 WP_001181004.1.5433 WP_001181004.1.5434 WP_001181004.1.54344 WP_001181004.1.54359 WP_001181004.1.54388 WP_001181004.1.54394 WP_001181004.1.5440 WP_001181004.1.5441 WP_001181004.1.54411 WP_001181004.1.54417 WP_001181004.1.54418 WP_001181004.1.54429 WP_001181004.1.54439 WP_001181004.1.54454 WP_001181004.1.54463 WP_001181004.1.54476 WP_001181004.1.54507 WP_001181004.1.54524 WP_001181004.1.54534 WP_001181004.1.54546 WP_001181004.1.54585 WP_001181004.1.54590 WP_001181004.1.54591 WP_001181004.1.5460 WP_001181004.1.54601 WP_001181004.1.54602 WP_001181004.1.54605 WP_001181004.1.5461 WP_001181004.1.54614 WP_001181004.1.54617 WP_001181004.1.54620 WP_001181004.1.54625 WP_001181004.1.54638 WP_001181004.1.54641 WP_001181004.1.54643 WP_001181004.1.5467 WP_001181004.1.54688 WP_001181004.1.54695 WP_001181004.1.5470 WP_001181004.1.54708 WP_001181004.1.54725 WP_001181004.1.54729 WP_001181004.1.54754 WP_001181004.1.54755 WP_001181004.1.54760 WP_001181004.1.54769 WP_001181004.1.5478 WP_001181004.1.5479 WP_001181004.1.54798 WP_001181004.1.54817 WP_001181004.1.54829 WP_001181004.1.5486 WP_001181004.1.54875 WP_001181004.1.54883 WP_001181004.1.54918 WP_001181004.1.54921 WP_001181004.1.54927 WP_001181004.1.54940 WP_001181004.1.54941 WP_001181004.1.54946 WP_001181004.1.54972 WP_001181004.1.54981 WP_001181004.1.54991 WP_001181004.1.54993 WP_001181004.1.55003 WP_001181004.1.55005 WP_001181004.1.55009 WP_001181004.1.55041 WP_001181004.1.55070 WP_001181004.1.55112 WP_001181004.1.55115 WP_001181004.1.55123 WP_001181004.1.55134 WP_001181004.1.55144 WP_001181004.1.55149 WP_001181004.1.55151 WP_001181004.1.55177 WP_001181004.1.55179 WP_001181004.1.55185 WP_001181004.1.55197 WP_001181004.1.5520 WP_001181004.1.55203 WP_001181004.1.55218 WP_001181004.1.55222 WP_001181004.1.55226 WP_001181004.1.55273 WP_001181004.1.55275 WP_001181004.1.55286 WP_001181004.1.55291 WP_001181004.1.55338 WP_001181004.1.55342 WP_001181004.1.55357 WP_001181004.1.55359 WP_001181004.1.55374 WP_001181004.1.55381 WP_001181004.1.55417 WP_001181004.1.55420 WP_001181004.1.55424 WP_001181004.1.55425 WP_001181004.1.5546 WP_001181004.1.55466 WP_001181004.1.55472 WP_001181004.1.55482 WP_001181004.1.55483 WP_001181004.1.55489 WP_001181004.1.55492 WP_001181004.1.55507 WP_001181004.1.55529 WP_001181004.1.55550 WP_001181004.1.55551 WP_001181004.1.55552 WP_001181004.1.55556 WP_001181004.1.55560 WP_001181004.1.55563 WP_001181004.1.55571 WP_001181004.1.55574 WP_001181004.1.55581 WP_001181004.1.55597 WP_001181004.1.55608 WP_001181004.1.5561 WP_001181004.1.55629 WP_001181004.1.5566 WP_001181004.1.55676 WP_001181004.1.5570 WP_001181004.1.55709 WP_001181004.1.55720 WP_001181004.1.55727 WP_001181004.1.55730 WP_001181004.1.55731 WP_001181004.1.55744 WP_001181004.1.55757 WP_001181004.1.55787 WP_001181004.1.55790 WP_001181004.1.55791 WP_001181004.1.55808 WP_001181004.1.55820 WP_001181004.1.55825 WP_001181004.1.55838 WP_001181004.1.55844 WP_001181004.1.55868 WP_001181004.1.55870 WP_001181004.1.55888 WP_001181004.1.55892 WP_001181004.1.55896 WP_001181004.1.55897 WP_001181004.1.55936 WP_001181004.1.55979 WP_001181004.1.55981 WP_001181004.1.55988 WP_001181004.1.55990 WP_001181004.1.56033 WP_001181004.1.56040 WP_001181004.1.56047 WP_001181004.1.56072 WP_001181004.1.561 WP_001181004.1.56101 WP_001181004.1.56122 WP_001181004.1.56139 WP_001181004.1.5614 WP_001181004.1.56142 WP_001181004.1.56149 WP_001181004.1.56151 WP_001181004.1.5616 WP_001181004.1.56164 WP_001181004.1.56169 WP_001181004.1.56177 WP_001181004.1.56193 WP_001181004.1.56197 WP_001181004.1.562 WP_001181004.1.56216 WP_001181004.1.56231 WP_001181004.1.56278 WP_001181004.1.56285 WP_001181004.1.56293 WP_001181004.1.56302 WP_001181004.1.5632 WP_001181004.1.56338 WP_001181004.1.56345 WP_001181004.1.56358 WP_001181004.1.56371 WP_001181004.1.56388 WP_001181004.1.5639 WP_001181004.1.56390 WP_001181004.1.56392 WP_001181004.1.56399 WP_001181004.1.56402 WP_001181004.1.56436 WP_001181004.1.56439 WP_001181004.1.56446 WP_001181004.1.56457 WP_001181004.1.5646 WP_001181004.1.56469 WP_001181004.1.56481 WP_001181004.1.56489 WP_001181004.1.5649 WP_001181004.1.56491 WP_001181004.1.56501 WP_001181004.1.56502 WP_001181004.1.56513 WP_001181004.1.56523 WP_001181004.1.56528 WP_001181004.1.56543 WP_001181004.1.56554 WP_001181004.1.56571 WP_001181004.1.56573 WP_001181004.1.56586 WP_001181004.1.56650 WP_001181004.1.56662 WP_001181004.1.56665 WP_001181004.1.56680 WP_001181004.1.56689 WP_001181004.1.5670 WP_001181004.1.56704 WP_001181004.1.56713 WP_001181004.1.56714 WP_001181004.1.56721 WP_001181004.1.56742 WP_001181004.1.56776 WP_001181004.1.56777 WP_001181004.1.56786 WP_001181004.1.56787 WP_001181004.1.56789 WP_001181004.1.56799 WP_001181004.1.56821 WP_001181004.1.56830 WP_001181004.1.56835 WP_001181004.1.56846 WP_001181004.1.5685 WP_001181004.1.56871 WP_001181004.1.56882 WP_001181004.1.56885 WP_001181004.1.56908 WP_001181004.1.56932 WP_001181004.1.56933 WP_001181004.1.56934 WP_001181004.1.56936 WP_001181004.1.56937 WP_001181004.1.56941 WP_001181004.1.56951 WP_001181004.1.56978 WP_001181004.1.56980 WP_001181004.1.56992 WP_001181004.1.57011 WP_001181004.1.57032 WP_001181004.1.57045 WP_001181004.1.57051 WP_001181004.1.57068 WP_001181004.1.57071 WP_001181004.1.57072 WP_001181004.1.57079 WP_001181004.1.57086 WP_001181004.1.57100 WP_001181004.1.57124 WP_001181004.1.57150 WP_001181004.1.57159 WP_001181004.1.57180 WP_001181004.1.57181 WP_001181004.1.57182 WP_001181004.1.57185 WP_001181004.1.57197 WP_001181004.1.57202 WP_001181004.1.57213 WP_001181004.1.57216 WP_001181004.1.57222 WP_001181004.1.57254 WP_001181004.1.57266 WP_001181004.1.57269 WP_001181004.1.57278 WP_001181004.1.57280 WP_001181004.1.57281 WP_001181004.1.57319 WP_001181004.1.57349 WP_001181004.1.57386 WP_001181004.1.57395 WP_001181004.1.57401 WP_001181004.1.57403 WP_001181004.1.57410 WP_001181004.1.57414 WP_001181004.1.5742 WP_001181004.1.57432 WP_001181004.1.57438 WP_001181004.1.57451 WP_001181004.1.57453 WP_001181004.1.57466 WP_001181004.1.5748 WP_001181004.1.57487 WP_001181004.1.57492 WP_001181004.1.57517 WP_001181004.1.57538 WP_001181004.1.57539 WP_001181004.1.5755 WP_001181004.1.57550 WP_001181004.1.57558 WP_001181004.1.57574 WP_001181004.1.57588 WP_001181004.1.57608 WP_001181004.1.57610 WP_001181004.1.57628 WP_001181004.1.57629 WP_001181004.1.57634 WP_001181004.1.57638 WP_001181004.1.5764 WP_001181004.1.57646 WP_001181004.1.57659 WP_001181004.1.57663 WP_001181004.1.57669 WP_001181004.1.57719 WP_001181004.1.57738 WP_001181004.1.57812 WP_001181004.1.57814 WP_001181004.1.57832 WP_001181004.1.57836 WP_001181004.1.57846 WP_001181004.1.57851 WP_001181004.1.57854 WP_001181004.1.5786 WP_001181004.1.5787 WP_001181004.1.57898 WP_001181004.1.57903 WP_001181004.1.57904 WP_001181004.1.57920 WP_001181004.1.57951 WP_001181004.1.57975 WP_001181004.1.57982 WP_001181004.1.57983 WP_001181004.1.57994 WP_001181004.1.58001 WP_001181004.1.58009 WP_001181004.1.58022 WP_001181004.1.58038 WP_001181004.1.58045 WP_001181004.1.58048 WP_001181004.1.58057 WP_001181004.1.58060 WP_001181004.1.58080 WP_001181004.1.58092 WP_001181004.1.58094 WP_001181004.1.58097 WP_001181004.1.58098 WP_001181004.1.5810 WP_001181004.1.58107 WP_001181004.1.5812 WP_001181004.1.58128 WP_001181004.1.58136 WP_001181004.1.58143 WP_001181004.1.58146 WP_001181004.1.58163 WP_001181004.1.58169 WP_001181004.1.58172 WP_001181004.1.58206 WP_001181004.1.58226 WP_001181004.1.58232 WP_001181004.1.58233 WP_001181004.1.58238 WP_001181004.1.58244 WP_001181004.1.58248 WP_001181004.1.58267 WP_001181004.1.58289 WP_001181004.1.58292 WP_001181004.1.58316 WP_001181004.1.58336 WP_001181004.1.58340 WP_001181004.1.58345 WP_001181004.1.58368 WP_001181004.1.58371 WP_001181004.1.58384 WP_001181004.1.584 WP_001181004.1.58401 WP_001181004.1.58408 WP_001181004.1.58414 WP_001181004.1.5842 WP_001181004.1.58420 WP_001181004.1.58423 WP_001181004.1.58424 WP_001181004.1.58429 WP_001181004.1.58440 WP_001181004.1.58444 WP_001181004.1.58445 WP_001181004.1.58449 WP_001181004.1.58459 WP_001181004.1.58475 WP_001181004.1.58484 WP_001181004.1.58493 WP_001181004.1.58496 WP_001181004.1.585 WP_001181004.1.58507 WP_001181004.1.58514 WP_001181004.1.5852 WP_001181004.1.58528 WP_001181004.1.58547 WP_001181004.1.58552 WP_001181004.1.58560 WP_001181004.1.58572 WP_001181004.1.58582 WP_001181004.1.58609 WP_001181004.1.58617 WP_001181004.1.58622 WP_001181004.1.58657 WP_001181004.1.58680 WP_001181004.1.58692 WP_001181004.1.58705 WP_001181004.1.58707 WP_001181004.1.58723 WP_001181004.1.58737 WP_001181004.1.58799 WP_001181004.1.58837 WP_001181004.1.58867 WP_001181004.1.58870 WP_001181004.1.58901 WP_001181004.1.58940 WP_001181004.1.58942 WP_001181004.1.58951 WP_001181004.1.58958 WP_001181004.1.58976 WP_001181004.1.58977 WP_001181004.1.58983 WP_001181004.1.58999 WP_001181004.1.59024 WP_001181004.1.59026 WP_001181004.1.59035 WP_001181004.1.59038 WP_001181004.1.59047 WP_001181004.1.59055 WP_001181004.1.5906 WP_001181004.1.59060 WP_001181004.1.59073 WP_001181004.1.59083 WP_001181004.1.59119 WP_001181004.1.59165 WP_001181004.1.59174 WP_001181004.1.59190 WP_001181004.1.59199 WP_001181004.1.59218 WP_001181004.1.59263 WP_001181004.1.5927 WP_001181004.1.59280 WP_001181004.1.59291 WP_001181004.1.59292 WP_001181004.1.59293 WP_001181004.1.59302 WP_001181004.1.59306 WP_001181004.1.59359 WP_001181004.1.59374 WP_001181004.1.59395 WP_001181004.1.59396 WP_001181004.1.59407 WP_001181004.1.59409 WP_001181004.1.59413 WP_001181004.1.5942 WP_001181004.1.59423 WP_001181004.1.59425 WP_001181004.1.59426 WP_001181004.1.59434 WP_001181004.1.59470 WP_001181004.1.59483 WP_001181004.1.59491 WP_001181004.1.59513 WP_001181004.1.59533 WP_001181004.1.59553 WP_001181004.1.59572 WP_001181004.1.59577 WP_001181004.1.59579 WP_001181004.1.59611 WP_001181004.1.59613 WP_001181004.1.59615 WP_001181004.1.59621 WP_001181004.1.5963 WP_001181004.1.59638 WP_001181004.1.5965 WP_001181004.1.59660 WP_001181004.1.59679 WP_001181004.1.59689 WP_001181004.1.59699 WP_001181004.1.597 WP_001181004.1.59714 WP_001181004.1.59717 WP_001181004.1.59730 WP_001181004.1.59733 WP_001181004.1.59737 WP_001181004.1.59745 WP_001181004.1.59748 WP_001181004.1.59756 WP_001181004.1.59781 WP_001181004.1.59782 WP_001181004.1.59788 WP_001181004.1.59791 WP_001181004.1.59793 WP_001181004.1.59815 WP_001181004.1.59823 WP_001181004.1.59836 WP_001181004.1.59838 WP_001181004.1.59853 WP_001181004.1.59855 WP_001181004.1.59858 WP_001181004.1.59877 WP_001181004.1.59894 WP_001181004.1.5990 WP_001181004.1.59900 WP_001181004.1.59905 WP_001181004.1.59912 WP_001181004.1.59914 WP_001181004.1.59931 WP_001181004.1.59932 WP_001181004.1.59959 WP_001181004.1.59970 WP_001181004.1.59980 WP_001181004.1.59981 WP_001181004.1.59989 WP_001181004.1.59998 WP_001181004.1.60005 WP_001181004.1.6002 WP_001181004.1.60023 WP_001181004.1.60031 WP_001181004.1.60042 WP_001181004.1.60043 WP_001181004.1.60048 WP_001181004.1.60067 WP_001181004.1.60070 WP_001181004.1.60095 WP_001181004.1.60096 WP_001181004.1.60110 WP_001181004.1.60117 WP_001181004.1.6013 WP_001181004.1.60133 WP_001181004.1.60151 WP_001181004.1.60186 WP_001181004.1.6022 WP_001181004.1.60225 WP_001181004.1.60228 WP_001181004.1.60235 WP_001181004.1.60246 WP_001181004.1.60304 WP_001181004.1.60325 WP_001181004.1.60337 WP_001181004.1.60342 WP_001181004.1.60343 WP_001181004.1.60350 WP_001181004.1.60373 WP_001181004.1.60374 WP_001181004.1.60387 WP_001181004.1.60411 WP_001181004.1.60436 WP_001181004.1.60443 WP_001181004.1.60453 WP_001181004.1.60457 WP_001181004.1.60461 WP_001181004.1.60477 WP_001181004.1.60491 WP_001181004.1.60498 WP_001181004.1.60505 WP_001181004.1.60544 WP_001181004.1.60550 WP_001181004.1.60555 WP_001181004.1.60559 WP_001181004.1.60567 WP_001181004.1.60570 WP_001181004.1.60576 WP_001181004.1.6059 WP_001181004.1.60591 WP_001181004.1.60599 WP_001181004.1.60606 WP_001181004.1.6061 WP_001181004.1.60613 WP_001181004.1.60614 WP_001181004.1.60630 WP_001181004.1.6064 WP_001181004.1.60644 WP_001181004.1.60647 WP_001181004.1.60654 WP_001181004.1.6066 WP_001181004.1.60671 WP_001181004.1.6068 WP_001181004.1.60684 WP_001181004.1.60698 WP_001181004.1.60717 WP_001181004.1.60732 WP_001181004.1.60744 WP_001181004.1.60761 WP_001181004.1.60764 WP_001181004.1.60771 WP_001181004.1.60784 WP_001181004.1.60805 WP_001181004.1.60816 WP_001181004.1.60826 WP_001181004.1.60832 WP_001181004.1.60835 WP_001181004.1.60847 WP_001181004.1.60872 WP_001181004.1.60895 WP_001181004.1.60901 WP_001181004.1.60921 WP_001181004.1.60925 WP_001181004.1.60927 WP_001181004.1.60935 WP_001181004.1.6094 WP_001181004.1.60974 WP_001181004.1.61005 WP_001181004.1.61006 WP_001181004.1.61008 WP_001181004.1.61035 WP_001181004.1.61039 WP_001181004.1.61046 WP_001181004.1.61058 WP_001181004.1.6106 WP_001181004.1.61096 WP_001181004.1.61097 WP_001181004.1.61099 WP_001181004.1.6110 WP_001181004.1.61102 WP_001181004.1.61108 WP_001181004.1.61112 WP_001181004.1.61121 WP_001181004.1.61132 WP_001181004.1.61148 WP_001181004.1.61170 WP_001181004.1.61174 WP_001181004.1.61175 WP_001181004.1.61181 WP_001181004.1.61183 WP_001181004.1.61186 WP_001181004.1.61223 WP_001181004.1.61225 WP_001181004.1.61241 WP_001181004.1.61245 WP_001181004.1.61253 WP_001181004.1.61268 WP_001181004.1.61284 WP_001181004.1.61292 WP_001181004.1.613 WP_001181004.1.61360 WP_001181004.1.61362 WP_001181004.1.61364 WP_001181004.1.61373 WP_001181004.1.6138 WP_001181004.1.61398 WP_001181004.1.61442 WP_001181004.1.61445 WP_001181004.1.61480 WP_001181004.1.61496 WP_001181004.1.615 WP_001181004.1.61505 WP_001181004.1.61512 WP_001181004.1.61517 WP_001181004.1.61524 WP_001181004.1.61551 WP_001181004.1.61608 WP_001181004.1.61612 WP_001181004.1.61617 WP_001181004.1.61623 WP_001181004.1.61636 WP_001181004.1.61643 WP_001181004.1.61663 WP_001181004.1.61703 WP_001181004.1.61718 WP_001181004.1.61739 WP_001181004.1.61758 WP_001181004.1.61770 WP_001181004.1.61772 WP_001181004.1.61779 WP_001181004.1.61789 WP_001181004.1.618 WP_001181004.1.61806 WP_001181004.1.61822 WP_001181004.1.61835 WP_001181004.1.61853 WP_001181004.1.61858 WP_001181004.1.61874 WP_001181004.1.61893 WP_001181004.1.61926 WP_001181004.1.61939 WP_001181004.1.61948 WP_001181004.1.61949 WP_001181004.1.61955 WP_001181004.1.61957 WP_001181004.1.61966 WP_001181004.1.61985 WP_001181004.1.62015 WP_001181004.1.62038 WP_001181004.1.62041 WP_001181004.1.62043 WP_001181004.1.62091 WP_001181004.1.62099 WP_001181004.1.62102 WP_001181004.1.6212 WP_001181004.1.62135 WP_001181004.1.62157 WP_001181004.1.62182 WP_001181004.1.62207 WP_001181004.1.62236 WP_001181004.1.62262 WP_001181004.1.62264 WP_001181004.1.62266 WP_001181004.1.62273 WP_001181004.1.62282 WP_001181004.1.62290 WP_001181004.1.62296 WP_001181004.1.62303 WP_001181004.1.62322 WP_001181004.1.62337 WP_001181004.1.62348 WP_001181004.1.62358 WP_001181004.1.62424 WP_001181004.1.62447 WP_001181004.1.6245 WP_001181004.1.62454 WP_001181004.1.62460 WP_001181004.1.62480 WP_001181004.1.62481 WP_001181004.1.62487 WP_001181004.1.62503 WP_001181004.1.62507 WP_001181004.1.62513 WP_001181004.1.62514 WP_001181004.1.62529 WP_001181004.1.62541 WP_001181004.1.62555 WP_001181004.1.62586 WP_001181004.1.6261 WP_001181004.1.62612 WP_001181004.1.62631 WP_001181004.1.62642 WP_001181004.1.62646 WP_001181004.1.62668 WP_001181004.1.62675 WP_001181004.1.62681 WP_001181004.1.62714 WP_001181004.1.62735 WP_001181004.1.62750 WP_001181004.1.62762 WP_001181004.1.62769 WP_001181004.1.62780 WP_001181004.1.62784 WP_001181004.1.62787 WP_001181004.1.62788 WP_001181004.1.62802 WP_001181004.1.62812 WP_001181004.1.62818 WP_001181004.1.62819 WP_001181004.1.6282 WP_001181004.1.62840 WP_001181004.1.62843 WP_001181004.1.62850 WP_001181004.1.62851 WP_001181004.1.62866 WP_001181004.1.62885 WP_001181004.1.62888 WP_001181004.1.62914 WP_001181004.1.62919 WP_001181004.1.6293 WP_001181004.1.62931 WP_001181004.1.62951 WP_001181004.1.62959 WP_001181004.1.62973 WP_001181004.1.62989 WP_001181004.1.6299 WP_001181004.1.62992 WP_001181004.1.63023 WP_001181004.1.6307 WP_001181004.1.63078 WP_001181004.1.63113 WP_001181004.1.63167 WP_001181004.1.63177 WP_001181004.1.63189 WP_001181004.1.6323 WP_001181004.1.63246 WP_001181004.1.63271 WP_001181004.1.63285 WP_001181004.1.63287 WP_001181004.1.63305 WP_001181004.1.6331 WP_001181004.1.63310 WP_001181004.1.63330 WP_001181004.1.6334 WP_001181004.1.63350 WP_001181004.1.6337 WP_001181004.1.63370 WP_001181004.1.63374 WP_001181004.1.63393 WP_001181004.1.63419 WP_001181004.1.63433 WP_001181004.1.63435 WP_001181004.1.63437 WP_001181004.1.63444 WP_001181004.1.63445 WP_001181004.1.63453 WP_001181004.1.63465 WP_001181004.1.63466 WP_001181004.1.63467 WP_001181004.1.63470 WP_001181004.1.63478 WP_001181004.1.6348 WP_001181004.1.63484 WP_001181004.1.63487 WP_001181004.1.63491 WP_001181004.1.63496 WP_001181004.1.63536 WP_001181004.1.63554 WP_001181004.1.63556 WP_001181004.1.63563 WP_001181004.1.63576 WP_001181004.1.63586 WP_001181004.1.63602 WP_001181004.1.63604 WP_001181004.1.63608 WP_001181004.1.63612 WP_001181004.1.63615 WP_001181004.1.6364 WP_001181004.1.63666 WP_001181004.1.63679 WP_001181004.1.63683 WP_001181004.1.63703 WP_001181004.1.63721 WP_001181004.1.63746 WP_001181004.1.63800 WP_001181004.1.63810 WP_001181004.1.63814 WP_001181004.1.63821 WP_001181004.1.63856 WP_001181004.1.63871 WP_001181004.1.63872 WP_001181004.1.63944 WP_001181004.1.63957 WP_001181004.1.63964 WP_001181004.1.63969 WP_001181004.1.63990 WP_001181004.1.64008 WP_001181004.1.64014 WP_001181004.1.64030 WP_001181004.1.64040 WP_001181004.1.64045 WP_001181004.1.64050 WP_001181004.1.64053 WP_001181004.1.64074 WP_001181004.1.64080 WP_001181004.1.64086 WP_001181004.1.64110 WP_001181004.1.64138 WP_001181004.1.64150 WP_001181004.1.64153 WP_001181004.1.6416 WP_001181004.1.64161 WP_001181004.1.64165 WP_001181004.1.64175 WP_001181004.1.64180 WP_001181004.1.64190 WP_001181004.1.64193 WP_001181004.1.64280 WP_001181004.1.64285 WP_001181004.1.64286 WP_001181004.1.643 WP_001181004.1.6431 WP_001181004.1.64312 WP_001181004.1.64321 WP_001181004.1.64330 WP_001181004.1.64337 WP_001181004.1.64353 WP_001181004.1.64355 WP_001181004.1.64356 WP_001181004.1.64371 WP_001181004.1.64380 WP_001181004.1.64391 WP_001181004.1.6441 WP_001181004.1.64417 WP_001181004.1.64437 WP_001181004.1.64438 WP_001181004.1.6444 WP_001181004.1.64448 WP_001181004.1.6445 WP_001181004.1.64458 WP_001181004.1.6446 WP_001181004.1.64519 WP_001181004.1.64520 WP_001181004.1.64528 WP_001181004.1.64540 WP_001181004.1.64547 WP_001181004.1.64563 WP_001181004.1.64621 WP_001181004.1.64634 WP_001181004.1.64657 WP_001181004.1.64670 WP_001181004.1.6469 WP_001181004.1.64693 WP_001181004.1.64695 WP_001181004.1.647 WP_001181004.1.64707 WP_001181004.1.64712 WP_001181004.1.64746 WP_001181004.1.64749 WP_001181004.1.64784 WP_001181004.1.64789 WP_001181004.1.64793 WP_001181004.1.64821 WP_001181004.1.64840 WP_001181004.1.64866 WP_001181004.1.64875 WP_001181004.1.64881 WP_001181004.1.64895 WP_001181004.1.64901 WP_001181004.1.64912 WP_001181004.1.64926 WP_001181004.1.64930 WP_001181004.1.64939 WP_001181004.1.64946 WP_001181004.1.64970 WP_001181004.1.6499 WP_001181004.1.64990 WP_001181004.1.6500 WP_001181004.1.65023 WP_001181004.1.65035 WP_001181004.1.65040 WP_001181004.1.65056 WP_001181004.1.65061 WP_001181004.1.65084 WP_001181004.1.65085 WP_001181004.1.65097 WP_001181004.1.651 WP_001181004.1.65104 WP_001181004.1.6511 WP_001181004.1.65110 WP_001181004.1.65114 WP_001181004.1.65116 WP_001181004.1.65118 WP_001181004.1.65122 WP_001181004.1.65135 WP_001181004.1.65151 WP_001181004.1.65155 WP_001181004.1.6516 WP_001181004.1.65179 WP_001181004.1.65192 WP_001181004.1.65194 WP_001181004.1.65206 WP_001181004.1.65240 WP_001181004.1.65256 WP_001181004.1.6527 WP_001181004.1.65271 WP_001181004.1.65286 WP_001181004.1.65296 WP_001181004.1.65305 WP_001181004.1.65306 WP_001181004.1.65353 WP_001181004.1.65355 WP_001181004.1.65364 WP_001181004.1.65366 WP_001181004.1.6537 WP_001181004.1.65370 WP_001181004.1.65372 WP_001181004.1.654 WP_001181004.1.65405 WP_001181004.1.65408 WP_001181004.1.65413 WP_001181004.1.65415 WP_001181004.1.65456 WP_001181004.1.65493 WP_001181004.1.6553 WP_001181004.1.65531 WP_001181004.1.65546 WP_001181004.1.65565 WP_001181004.1.65571 WP_001181004.1.65581 WP_001181004.1.65596 WP_001181004.1.65606 WP_001181004.1.6563 WP_001181004.1.65662 WP_001181004.1.65667 WP_001181004.1.65672 WP_001181004.1.65677 WP_001181004.1.65708 WP_001181004.1.65714 WP_001181004.1.65749 WP_001181004.1.6576 WP_001181004.1.65762 WP_001181004.1.65834 WP_001181004.1.6587 WP_001181004.1.65875 WP_001181004.1.65898 WP_001181004.1.65912 WP_001181004.1.65954 WP_001181004.1.65957 WP_001181004.1.65961 WP_001181004.1.65962 WP_001181004.1.65963 WP_001181004.1.65978 WP_001181004.1.65988 WP_001181004.1.6599 WP_001181004.1.65991 WP_001181004.1.66001 WP_001181004.1.66007 WP_001181004.1.66016 WP_001181004.1.66017 WP_001181004.1.66022 WP_001181004.1.66033 WP_001181004.1.6604 WP_001181004.1.66044 WP_001181004.1.66050 WP_001181004.1.66059 WP_001181004.1.66071 WP_001181004.1.6609 WP_001181004.1.66094 WP_001181004.1.66100 WP_001181004.1.66102 WP_001181004.1.66104 WP_001181004.1.66105 WP_001181004.1.66121 WP_001181004.1.66127 WP_001181004.1.66161 WP_001181004.1.6618 WP_001181004.1.66181 WP_001181004.1.66187 WP_001181004.1.66197 WP_001181004.1.6622 WP_001181004.1.66251 WP_001181004.1.66255 WP_001181004.1.66264 WP_001181004.1.66280 WP_001181004.1.66288 WP_001181004.1.66290 WP_001181004.1.66295 WP_001181004.1.66327 WP_001181004.1.66335 WP_001181004.1.6635 WP_001181004.1.66376 WP_001181004.1.66387 WP_001181004.1.66389 WP_001181004.1.66392 WP_001181004.1.66395 WP_001181004.1.66412 WP_001181004.1.66421 WP_001181004.1.66432 WP_001181004.1.66448 WP_001181004.1.6645 WP_001181004.1.66501 WP_001181004.1.66511 WP_001181004.1.66523 WP_001181004.1.66531 WP_001181004.1.6654 WP_001181004.1.66550 WP_001181004.1.66559 WP_001181004.1.66566 WP_001181004.1.66579 WP_001181004.1.66624 WP_001181004.1.66644 WP_001181004.1.6665 WP_001181004.1.6666 WP_001181004.1.66667 WP_001181004.1.66668 WP_001181004.1.66700 WP_001181004.1.66706 WP_001181004.1.66708 WP_001181004.1.66719 WP_001181004.1.66727 WP_001181004.1.66751 WP_001181004.1.66758 WP_001181004.1.6676 WP_001181004.1.66783 WP_001181004.1.66787 WP_001181004.1.66791 WP_001181004.1.66794 WP_001181004.1.66795 WP_001181004.1.66796 WP_001181004.1.66849 WP_001181004.1.66873 WP_001181004.1.66922 WP_001181004.1.66926 WP_001181004.1.66933 WP_001181004.1.66948 WP_001181004.1.66975 WP_001181004.1.66978 WP_001181004.1.6698 WP_001181004.1.66984 WP_001181004.1.6701 WP_001181004.1.67018 WP_001181004.1.67021 WP_001181004.1.67022 WP_001181004.1.67026 WP_001181004.1.67029 WP_001181004.1.67035 WP_001181004.1.67047 WP_001181004.1.67055 WP_001181004.1.6706 WP_001181004.1.67073 WP_001181004.1.67102 WP_001181004.1.67116 WP_001181004.1.67120 WP_001181004.1.67132 WP_001181004.1.67136 WP_001181004.1.67137 WP_001181004.1.67149 WP_001181004.1.67150 WP_001181004.1.67153 WP_001181004.1.67158 WP_001181004.1.67164 WP_001181004.1.67174 WP_001181004.1.67193 WP_001181004.1.67194 WP_001181004.1.67200 WP_001181004.1.67209 WP_001181004.1.67210 WP_001181004.1.67214 WP_001181004.1.6723 WP_001181004.1.67258 WP_001181004.1.67272 WP_001181004.1.67278 WP_001181004.1.67284 WP_001181004.1.67293 WP_001181004.1.6735 WP_001181004.1.67373 WP_001181004.1.67383 WP_001181004.1.67415 WP_001181004.1.67427 WP_001181004.1.67446 WP_001181004.1.67451 WP_001181004.1.67452 WP_001181004.1.67454 WP_001181004.1.67456 WP_001181004.1.67462 WP_001181004.1.67464 WP_001181004.1.67467 WP_001181004.1.67468 WP_001181004.1.67495 WP_001181004.1.67522 WP_001181004.1.67533 WP_001181004.1.67538 WP_001181004.1.67549 WP_001181004.1.67553 WP_001181004.1.67581 WP_001181004.1.67590 WP_001181004.1.67606 WP_001181004.1.67660 WP_001181004.1.67663 WP_001181004.1.67669 WP_001181004.1.67676 WP_001181004.1.67681 WP_001181004.1.67685 WP_001181004.1.6769 WP_001181004.1.67690 WP_001181004.1.67701 WP_001181004.1.67704 WP_001181004.1.67724 WP_001181004.1.67726 WP_001181004.1.67732 WP_001181004.1.67737 WP_001181004.1.67753 WP_001181004.1.67758 WP_001181004.1.67760 WP_001181004.1.67775 WP_001181004.1.67780 WP_001181004.1.67786 WP_001181004.1.67787 WP_001181004.1.67788 WP_001181004.1.678 WP_001181004.1.67802 WP_001181004.1.67810 WP_001181004.1.67841 WP_001181004.1.67853 WP_001181004.1.67861 WP_001181004.1.67891 WP_001181004.1.67894 WP_001181004.1.67901 WP_001181004.1.6793 WP_001181004.1.67938 WP_001181004.1.67971 WP_001181004.1.67975 WP_001181004.1.67984 WP_001181004.1.67990 WP_001181004.1.67992 WP_001181004.1.67999 WP_001181004.1.68008 WP_001181004.1.68011 WP_001181004.1.68012 WP_001181004.1.6802 WP_001181004.1.68025 WP_001181004.1.6803 WP_001181004.1.68039 WP_001181004.1.68052 WP_001181004.1.68053 WP_001181004.1.68058 WP_001181004.1.68059 WP_001181004.1.68063 WP_001181004.1.68067 WP_001181004.1.68069 WP_001181004.1.68070 WP_001181004.1.68071 WP_001181004.1.68079 WP_001181004.1.68096 WP_001181004.1.6810 WP_001181004.1.68108 WP_001181004.1.68126 WP_001181004.1.68138 WP_001181004.1.6814 WP_001181004.1.68145 WP_001181004.1.68157 WP_001181004.1.68170 WP_001181004.1.68175 WP_001181004.1.68177 WP_001181004.1.682 WP_001181004.1.68200 WP_001181004.1.68215 WP_001181004.1.68231 WP_001181004.1.68241 WP_001181004.1.68255 WP_001181004.1.68271 WP_001181004.1.68278 WP_001181004.1.68279 WP_001181004.1.68281 WP_001181004.1.68283 WP_001181004.1.68292 WP_001181004.1.68300 WP_001181004.1.68336 WP_001181004.1.68341 WP_001181004.1.68347 WP_001181004.1.68362 WP_001181004.1.68369 WP_001181004.1.68372 WP_001181004.1.68395 WP_001181004.1.68396 WP_001181004.1.68411 WP_001181004.1.68441 WP_001181004.1.68442 WP_001181004.1.68482 WP_001181004.1.68490 WP_001181004.1.68493 WP_001181004.1.68523 WP_001181004.1.68524 WP_001181004.1.68534 WP_001181004.1.68566 WP_001181004.1.68572 WP_001181004.1.68584 WP_001181004.1.6859 WP_001181004.1.68598 WP_001181004.1.6860 WP_001181004.1.68609 WP_001181004.1.68630 WP_001181004.1.68632 WP_001181004.1.68635 WP_001181004.1.68673 WP_001181004.1.68678 WP_001181004.1.68679 WP_001181004.1.68695 WP_001181004.1.68697 WP_001181004.1.68701 WP_001181004.1.68711 WP_001181004.1.68731 WP_001181004.1.68735 WP_001181004.1.68750 WP_001181004.1.68751 WP_001181004.1.68752 WP_001181004.1.6877 WP_001181004.1.68793 WP_001181004.1.68795 WP_001181004.1.68797 WP_001181004.1.6880 WP_001181004.1.68801 WP_001181004.1.68838 WP_001181004.1.68847 WP_001181004.1.68865 WP_001181004.1.6887 WP_001181004.1.68873 WP_001181004.1.68877 WP_001181004.1.68880 WP_001181004.1.68911 WP_001181004.1.68915 WP_001181004.1.6892 WP_001181004.1.68924 WP_001181004.1.68936 WP_001181004.1.68942 WP_001181004.1.68952 WP_001181004.1.68956 WP_001181004.1.68961 WP_001181004.1.6897 WP_001181004.1.68989 WP_001181004.1.68995 WP_001181004.1.69033 WP_001181004.1.69039 WP_001181004.1.69054 WP_001181004.1.69098 WP_001181004.1.69126 WP_001181004.1.69127 WP_001181004.1.69144 WP_001181004.1.69158 WP_001181004.1.6916 WP_001181004.1.69160 WP_001181004.1.6919 WP_001181004.1.69192 WP_001181004.1.6921 WP_001181004.1.69221 WP_001181004.1.6923 WP_001181004.1.69247 WP_001181004.1.69258 WP_001181004.1.69261 WP_001181004.1.6929 WP_001181004.1.69303 WP_001181004.1.69305 WP_001181004.1.69327 WP_001181004.1.69341 WP_001181004.1.69350 WP_001181004.1.69351 WP_001181004.1.69382 WP_001181004.1.69390 WP_001181004.1.694 WP_001181004.1.69404 WP_001181004.1.69438 WP_001181004.1.69441 WP_001181004.1.6945 WP_001181004.1.69450 WP_001181004.1.69472 WP_001181004.1.69473 WP_001181004.1.69502 WP_001181004.1.69506 WP_001181004.1.69537 WP_001181004.1.69569 WP_001181004.1.69583 WP_001181004.1.69589 WP_001181004.1.69593 WP_001181004.1.69596 WP_001181004.1.69605 WP_001181004.1.69643 WP_001181004.1.69646 WP_001181004.1.69649 WP_001181004.1.69655 WP_001181004.1.69689 WP_001181004.1.697 WP_001181004.1.69716 WP_001181004.1.69730 WP_001181004.1.69735 WP_001181004.1.69780 WP_001181004.1.69803 WP_001181004.1.69810 WP_001181004.1.69818 WP_001181004.1.69831 WP_001181004.1.69832 WP_001181004.1.69868 WP_001181004.1.69872 WP_001181004.1.69887 WP_001181004.1.69896 WP_001181004.1.6993 WP_001181004.1.69963 WP_001181004.1.69972 WP_001181004.1.69979 WP_001181004.1.69999 WP_001181004.1.7001 WP_001181004.1.70041 WP_001181004.1.70063 WP_001181004.1.70081 WP_001181004.1.701 WP_001181004.1.70123 WP_001181004.1.70125 WP_001181004.1.7013 WP_001181004.1.70149 WP_001181004.1.7015 WP_001181004.1.70190 WP_001181004.1.70191 WP_001181004.1.70200 WP_001181004.1.70213 WP_001181004.1.70230 WP_001181004.1.70251 WP_001181004.1.70256 WP_001181004.1.70264 WP_001181004.1.70299 WP_001181004.1.70300 WP_001181004.1.70337 WP_001181004.1.70341 WP_001181004.1.70357 WP_001181004.1.70370 WP_001181004.1.70386 WP_001181004.1.70407 WP_001181004.1.70408 WP_001181004.1.70414 WP_001181004.1.70477 WP_001181004.1.70492 WP_001181004.1.7050 WP_001181004.1.70509 WP_001181004.1.70517 WP_001181004.1.7052 WP_001181004.1.70530 WP_001181004.1.70539 WP_001181004.1.70563 WP_001181004.1.70576 WP_001181004.1.70578 WP_001181004.1.70582 WP_001181004.1.70592 WP_001181004.1.70597 WP_001181004.1.70600 WP_001181004.1.70619 WP_001181004.1.70628 WP_001181004.1.70655 WP_001181004.1.70656 WP_001181004.1.70686 WP_001181004.1.70694 WP_001181004.1.70698 WP_001181004.1.70705 WP_001181004.1.70713 WP_001181004.1.70723 WP_001181004.1.70728 WP_001181004.1.70745 WP_001181004.1.70747 WP_001181004.1.70748 WP_001181004.1.70767 WP_001181004.1.70787 WP_001181004.1.70794 WP_001181004.1.70801 WP_001181004.1.70803 WP_001181004.1.70880 WP_001181004.1.70896 WP_001181004.1.7090 WP_001181004.1.70900 WP_001181004.1.70952 WP_001181004.1.70967 WP_001181004.1.71003 WP_001181004.1.7102 WP_001181004.1.71024 WP_001181004.1.71037 WP_001181004.1.71042 WP_001181004.1.71062 WP_001181004.1.71099 WP_001181004.1.71109 WP_001181004.1.71113 WP_001181004.1.71134 WP_001181004.1.71139 WP_001181004.1.71144 WP_001181004.1.71147 WP_001181004.1.71149 WP_001181004.1.71158 WP_001181004.1.71159 WP_001181004.1.71162 WP_001181004.1.71170 WP_001181004.1.71176 WP_001181004.1.71183 WP_001181004.1.71192 WP_001181004.1.71199 WP_001181004.1.71205 WP_001181004.1.7121 WP_001181004.1.71221 WP_001181004.1.71223 WP_001181004.1.71225 WP_001181004.1.71226 WP_001181004.1.71229 WP_001181004.1.71264 WP_001181004.1.71269 WP_001181004.1.71272 WP_001181004.1.71273 WP_001181004.1.71275 WP_001181004.1.71285 WP_001181004.1.71287 WP_001181004.1.71294 WP_001181004.1.71311 WP_001181004.1.71312 WP_001181004.1.71315 WP_001181004.1.71323 WP_001181004.1.71327 WP_001181004.1.71339 WP_001181004.1.71354 WP_001181004.1.71397 WP_001181004.1.71403 WP_001181004.1.71405 WP_001181004.1.71409 WP_001181004.1.71421 WP_001181004.1.71423 WP_001181004.1.71448 WP_001181004.1.7147 WP_001181004.1.71480 WP_001181004.1.71522 WP_001181004.1.71533 WP_001181004.1.71537 WP_001181004.1.71538 WP_001181004.1.71540 WP_001181004.1.71560 WP_001181004.1.71562 WP_001181004.1.71563 WP_001181004.1.71603 WP_001181004.1.71607 WP_001181004.1.71632 WP_001181004.1.71680 WP_001181004.1.71690 WP_001181004.1.71695 WP_001181004.1.71712 WP_001181004.1.71724 WP_001181004.1.71732 WP_001181004.1.71757 WP_001181004.1.71767 WP_001181004.1.71783 WP_001181004.1.71830 WP_001181004.1.71832 WP_001181004.1.71837 WP_001181004.1.71840 WP_001181004.1.71855 WP_001181004.1.71856 WP_001181004.1.71874 WP_001181004.1.71912 WP_001181004.1.7192 WP_001181004.1.71922 WP_001181004.1.71938 WP_001181004.1.71939 WP_001181004.1.71940 WP_001181004.1.71944 WP_001181004.1.71945 WP_001181004.1.71967 WP_001181004.1.71972 WP_001181004.1.71975 WP_001181004.1.71987 WP_001181004.1.71993 WP_001181004.1.71995 WP_001181004.1.72013 WP_001181004.1.72016 WP_001181004.1.72021 WP_001181004.1.72028 WP_001181004.1.72033 WP_001181004.1.72048 WP_001181004.1.7205 WP_001181004.1.72053 WP_001181004.1.72054 WP_001181004.1.72066 WP_001181004.1.72090 WP_001181004.1.72098 WP_001181004.1.7210 WP_001181004.1.72117 WP_001181004.1.72120 WP_001181004.1.72125 WP_001181004.1.72126 WP_001181004.1.72141 WP_001181004.1.72153 WP_001181004.1.72155 WP_001181004.1.72157 WP_001181004.1.72161 WP_001181004.1.72162 WP_001181004.1.72180 WP_001181004.1.72184 WP_001181004.1.72186 WP_001181004.1.72208 WP_001181004.1.72212 WP_001181004.1.72237 WP_001181004.1.72240 WP_001181004.1.72248 WP_001181004.1.7225 WP_001181004.1.72258 WP_001181004.1.72261 WP_001181004.1.72262 WP_001181004.1.72270 WP_001181004.1.72279 WP_001181004.1.72290 WP_001181004.1.72293 WP_001181004.1.72298 WP_001181004.1.723 WP_001181004.1.72316 WP_001181004.1.72322 WP_001181004.1.72337 WP_001181004.1.72352 WP_001181004.1.72359 WP_001181004.1.72362 WP_001181004.1.72388 WP_001181004.1.72391 WP_001181004.1.72392 WP_001181004.1.72397 WP_001181004.1.72414 WP_001181004.1.72425 WP_001181004.1.72427 WP_001181004.1.72431 WP_001181004.1.72436 WP_001181004.1.72469 WP_001181004.1.72485 WP_001181004.1.72493 WP_001181004.1.72507 WP_001181004.1.72511 WP_001181004.1.72521 WP_001181004.1.72522 WP_001181004.1.72535 WP_001181004.1.72537 WP_001181004.1.72544 WP_001181004.1.72551 WP_001181004.1.72574 WP_001181004.1.72582 WP_001181004.1.72588 WP_001181004.1.72593 WP_001181004.1.72596 WP_001181004.1.72599 WP_001181004.1.72606 WP_001181004.1.72608 WP_001181004.1.72614 WP_001181004.1.72615 WP_001181004.1.72616 WP_001181004.1.72619 WP_001181004.1.72641 WP_001181004.1.72651 WP_001181004.1.72652 WP_001181004.1.72663 WP_001181004.1.72694 WP_001181004.1.72695 WP_001181004.1.72698 WP_001181004.1.72700 WP_001181004.1.72706 WP_001181004.1.72725 WP_001181004.1.72729 WP_001181004.1.72738 WP_001181004.1.72745 WP_001181004.1.72747 WP_001181004.1.72748 WP_001181004.1.72751 WP_001181004.1.72758 WP_001181004.1.72764 WP_001181004.1.7277 WP_001181004.1.72778 WP_001181004.1.72804 WP_001181004.1.72806 WP_001181004.1.7281 WP_001181004.1.72837 WP_001181004.1.72857 WP_001181004.1.72858 WP_001181004.1.72860 WP_001181004.1.72869 WP_001181004.1.72893 WP_001181004.1.7291 WP_001181004.1.72910 WP_001181004.1.72913 WP_001181004.1.72947 WP_001181004.1.72950 WP_001181004.1.72956 WP_001181004.1.72962 WP_001181004.1.72998 WP_001181004.1.73000 WP_001181004.1.73010 WP_001181004.1.73015 WP_001181004.1.73032 WP_001181004.1.73061 WP_001181004.1.7307 WP_001181004.1.73072 WP_001181004.1.73075 WP_001181004.1.73085 WP_001181004.1.7309 WP_001181004.1.73094 WP_001181004.1.73126 WP_001181004.1.73129 WP_001181004.1.73193 WP_001181004.1.73197 WP_001181004.1.73215 WP_001181004.1.73217 WP_001181004.1.73230 WP_001181004.1.73239 WP_001181004.1.73243 WP_001181004.1.73249 WP_001181004.1.73251 WP_001181004.1.73257 WP_001181004.1.73259 WP_001181004.1.73277 WP_001181004.1.73278 WP_001181004.1.73283 WP_001181004.1.73291 WP_001181004.1.73292 WP_001181004.1.73295 WP_001181004.1.73326 WP_001181004.1.73333 WP_001181004.1.73340 WP_001181004.1.73343 WP_001181004.1.73344 WP_001181004.1.73349 WP_001181004.1.73385 WP_001181004.1.73393 WP_001181004.1.73428 WP_001181004.1.73430 WP_001181004.1.7345 WP_001181004.1.73468 WP_001181004.1.73486 WP_001181004.1.7349 WP_001181004.1.73498 WP_001181004.1.73524 WP_001181004.1.73565 WP_001181004.1.73572 WP_001181004.1.73592 WP_001181004.1.73604 WP_001181004.1.73626 WP_001181004.1.73631 WP_001181004.1.73652 WP_001181004.1.73663 WP_001181004.1.73700 WP_001181004.1.73709 WP_001181004.1.73717 WP_001181004.1.73743 WP_001181004.1.73748 WP_001181004.1.7376 WP_001181004.1.73783 WP_001181004.1.73785 WP_001181004.1.73797 WP_001181004.1.73801 WP_001181004.1.73807 WP_001181004.1.73811 WP_001181004.1.73827 WP_001181004.1.73835 WP_001181004.1.73843 WP_001181004.1.73844 WP_001181004.1.73846 WP_001181004.1.73859 WP_001181004.1.73882 WP_001181004.1.73897 WP_001181004.1.73908 WP_001181004.1.7392 WP_001181004.1.73934 WP_001181004.1.73942 WP_001181004.1.73968 WP_001181004.1.73980 WP_001181004.1.73992 WP_001181004.1.73995 WP_001181004.1.73996 WP_001181004.1.74032 WP_001181004.1.74041 WP_001181004.1.74045 WP_001181004.1.74046 WP_001181004.1.74051 WP_001181004.1.74053 WP_001181004.1.7407 WP_001181004.1.7411 WP_001181004.1.74123 WP_001181004.1.7413 WP_001181004.1.74156 WP_001181004.1.74184 WP_001181004.1.74185 WP_001181004.1.74213 WP_001181004.1.74223 WP_001181004.1.7424 WP_001181004.1.74243 WP_001181004.1.74251 WP_001181004.1.74267 WP_001181004.1.7429 WP_001181004.1.74294 WP_001181004.1.74309 WP_001181004.1.74358 WP_001181004.1.74365 WP_001181004.1.74367 WP_001181004.1.744 WP_001181004.1.74423 WP_001181004.1.74426 WP_001181004.1.74431 WP_001181004.1.74444 WP_001181004.1.74445 WP_001181004.1.7446 WP_001181004.1.74465 WP_001181004.1.74478 WP_001181004.1.74491 WP_001181004.1.74501 WP_001181004.1.74509 WP_001181004.1.74513 WP_001181004.1.74520 WP_001181004.1.74521 WP_001181004.1.74528 WP_001181004.1.74532 WP_001181004.1.74536 WP_001181004.1.74549 WP_001181004.1.74557 WP_001181004.1.74574 WP_001181004.1.7461 WP_001181004.1.74611 WP_001181004.1.74623 WP_001181004.1.74624 WP_001181004.1.74625 WP_001181004.1.74631 WP_001181004.1.74652 WP_001181004.1.74670 WP_001181004.1.74682 WP_001181004.1.74687 WP_001181004.1.74688 WP_001181004.1.74689 WP_001181004.1.74691 WP_001181004.1.74705 WP_001181004.1.7471 WP_001181004.1.74713 WP_001181004.1.74716 WP_001181004.1.74720 WP_001181004.1.74735 WP_001181004.1.7475 WP_001181004.1.74752 WP_001181004.1.74765 WP_001181004.1.74767 WP_001181004.1.7478 WP_001181004.1.7479 WP_001181004.1.74793 WP_001181004.1.74811 WP_001181004.1.74828 WP_001181004.1.74844 WP_001181004.1.74852 WP_001181004.1.74854 WP_001181004.1.74860 WP_001181004.1.74867 WP_001181004.1.74873 WP_001181004.1.74879 WP_001181004.1.74880 WP_001181004.1.74885 WP_001181004.1.74889 WP_001181004.1.74895 WP_001181004.1.74904 WP_001181004.1.74914 WP_001181004.1.74915 WP_001181004.1.74962 WP_001181004.1.74975 WP_001181004.1.74993 WP_001181004.1.74998 WP_001181004.1.75003 WP_001181004.1.75029 WP_001181004.1.75030 WP_001181004.1.75050 WP_001181004.1.75087 WP_001181004.1.75100 WP_001181004.1.75112 WP_001181004.1.75118 WP_001181004.1.75124 WP_001181004.1.75136 WP_001181004.1.75138 WP_001181004.1.75139 WP_001181004.1.75143 WP_001181004.1.75145 WP_001181004.1.75149 WP_001181004.1.75155 WP_001181004.1.7516 WP_001181004.1.75164 WP_001181004.1.75181 WP_001181004.1.75209 WP_001181004.1.75218 WP_001181004.1.75219 WP_001181004.1.75221 WP_001181004.1.75228 WP_001181004.1.75243 WP_001181004.1.75247 WP_001181004.1.75254 WP_001181004.1.75270 WP_001181004.1.75272 WP_001181004.1.75306 WP_001181004.1.7536 WP_001181004.1.75360 WP_001181004.1.75367 WP_001181004.1.75382 WP_001181004.1.7539 WP_001181004.1.75419 WP_001181004.1.75428 WP_001181004.1.75435 WP_001181004.1.75465 WP_001181004.1.75491 WP_001181004.1.75505 WP_001181004.1.75507 WP_001181004.1.75515 WP_001181004.1.75529 WP_001181004.1.75536 WP_001181004.1.75537 WP_001181004.1.75557 WP_001181004.1.75568 WP_001181004.1.75577 WP_001181004.1.75588 WP_001181004.1.75594 WP_001181004.1.75602 WP_001181004.1.75612 WP_001181004.1.75629 WP_001181004.1.75644 WP_001181004.1.75653 WP_001181004.1.75672 WP_001181004.1.75676 WP_001181004.1.75679 WP_001181004.1.75687 WP_001181004.1.75694 WP_001181004.1.75696 WP_001181004.1.75698 WP_001181004.1.75699 WP_001181004.1.75725 WP_001181004.1.75735 WP_001181004.1.75758 WP_001181004.1.75767 WP_001181004.1.75786 WP_001181004.1.75803 WP_001181004.1.75808 WP_001181004.1.7583 WP_001181004.1.75839 WP_001181004.1.75853 WP_001181004.1.75892 WP_001181004.1.75918 WP_001181004.1.75922 WP_001181004.1.7597 WP_001181004.1.75973 WP_001181004.1.75983 WP_001181004.1.75989 WP_001181004.1.75995 WP_001181004.1.75999 WP_001181004.1.76005 WP_001181004.1.76009 WP_001181004.1.76019 WP_001181004.1.7603 WP_001181004.1.76030 WP_001181004.1.76036 WP_001181004.1.76039 WP_001181004.1.76054 WP_001181004.1.76057 WP_001181004.1.7608 WP_001181004.1.76087 WP_001181004.1.76089 WP_001181004.1.76103 WP_001181004.1.76118 WP_001181004.1.76119 WP_001181004.1.76129 WP_001181004.1.7613 WP_001181004.1.76152 WP_001181004.1.7617 WP_001181004.1.76184 WP_001181004.1.76189 WP_001181004.1.76194 WP_001181004.1.76196 WP_001181004.1.76211 WP_001181004.1.76237 WP_001181004.1.76268 WP_001181004.1.76269 WP_001181004.1.76305 WP_001181004.1.76312 WP_001181004.1.76325 WP_001181004.1.76335 WP_001181004.1.76361 WP_001181004.1.7637 WP_001181004.1.76376 WP_001181004.1.76384 WP_001181004.1.76387 WP_001181004.1.76390 WP_001181004.1.76407 WP_001181004.1.76446 WP_001181004.1.76448 WP_001181004.1.76452 WP_001181004.1.76460 WP_001181004.1.76462 WP_001181004.1.76466 WP_001181004.1.76469 WP_001181004.1.76477 WP_001181004.1.76504 WP_001181004.1.76542 WP_001181004.1.76544 WP_001181004.1.76547 WP_001181004.1.76562 WP_001181004.1.76595 WP_001181004.1.76596 WP_001181004.1.7661 WP_001181004.1.76612 WP_001181004.1.76619 WP_001181004.1.76643 WP_001181004.1.76656 WP_001181004.1.76660 WP_001181004.1.76697 WP_001181004.1.76701 WP_001181004.1.76705 WP_001181004.1.76707 WP_001181004.1.76712 WP_001181004.1.76751 WP_001181004.1.76759 WP_001181004.1.7680 WP_001181004.1.76815 WP_001181004.1.76827 WP_001181004.1.76831 WP_001181004.1.76840 WP_001181004.1.76863 WP_001181004.1.76884 WP_001181004.1.7689 WP_001181004.1.76909 WP_001181004.1.76918 WP_001181004.1.76933 WP_001181004.1.76948 WP_001181004.1.76957 WP_001181004.1.76961 WP_001181004.1.76965 WP_001181004.1.76966 WP_001181004.1.7699 WP_001181004.1.76994 WP_001181004.1.77007 WP_001181004.1.77015 WP_001181004.1.77022 WP_001181004.1.77036 WP_001181004.1.77042 WP_001181004.1.77057 WP_001181004.1.77070 WP_001181004.1.77081 WP_001181004.1.77099 WP_001181004.1.771 WP_001181004.1.77109 WP_001181004.1.77120 WP_001181004.1.77128 WP_001181004.1.77134 WP_001181004.1.77147 WP_001181004.1.77162 WP_001181004.1.77163 WP_001181004.1.77173 WP_001181004.1.77175 WP_001181004.1.77198 WP_001181004.1.77200 WP_001181004.1.77204 WP_001181004.1.77214 WP_001181004.1.77224 WP_001181004.1.77239 WP_001181004.1.77253 WP_001181004.1.77255 WP_001181004.1.77258 WP_001181004.1.77275 WP_001181004.1.7728 WP_001181004.1.77284 WP_001181004.1.77288 WP_001181004.1.7729 WP_001181004.1.77290 WP_001181004.1.77291 WP_001181004.1.77296 WP_001181004.1.7731 WP_001181004.1.77320 WP_001181004.1.77326 WP_001181004.1.77341 WP_001181004.1.77358 WP_001181004.1.77391 WP_001181004.1.77392 WP_001181004.1.77408 WP_001181004.1.77419 WP_001181004.1.77432 WP_001181004.1.77437 WP_001181004.1.77448 WP_001181004.1.77452 WP_001181004.1.77455 WP_001181004.1.77462 WP_001181004.1.7747 WP_001181004.1.77470 WP_001181004.1.77471 WP_001181004.1.77477 WP_001181004.1.77481 WP_001181004.1.77487 WP_001181004.1.77495 WP_001181004.1.775 WP_001181004.1.7750 WP_001181004.1.77503 WP_001181004.1.77511 WP_001181004.1.77542 WP_001181004.1.77551 WP_001181004.1.7756 WP_001181004.1.77577 WP_001181004.1.77581 WP_001181004.1.77595 WP_001181004.1.77600 WP_001181004.1.77608 WP_001181004.1.77626 WP_001181004.1.77632 WP_001181004.1.77636 WP_001181004.1.77643 WP_001181004.1.77644 WP_001181004.1.77648 WP_001181004.1.77657 WP_001181004.1.77707 WP_001181004.1.77725 WP_001181004.1.77741 WP_001181004.1.7775 WP_001181004.1.77760 WP_001181004.1.77767 WP_001181004.1.77768 WP_001181004.1.7780 WP_001181004.1.7781 WP_001181004.1.77813 WP_001181004.1.77816 WP_001181004.1.77826 WP_001181004.1.77833 WP_001181004.1.77876 WP_001181004.1.77929 WP_001181004.1.77949 WP_001181004.1.7795 WP_001181004.1.77950 WP_001181004.1.77961 WP_001181004.1.77979 WP_001181004.1.7799 WP_001181004.1.77999 WP_001181004.1.78000 WP_001181004.1.78007 WP_001181004.1.78010 WP_001181004.1.7804 WP_001181004.1.78041 WP_001181004.1.78059 WP_001181004.1.7806 WP_001181004.1.78063 WP_001181004.1.7808 WP_001181004.1.78089 WP_001181004.1.78097 WP_001181004.1.78099 WP_001181004.1.78101 WP_001181004.1.78102 WP_001181004.1.78131 WP_001181004.1.78183 WP_001181004.1.78187 WP_001181004.1.78188 WP_001181004.1.78196 WP_001181004.1.78202 WP_001181004.1.78232 WP_001181004.1.78233 WP_001181004.1.78235 WP_001181004.1.78297 WP_001181004.1.78305 WP_001181004.1.78321 WP_001181004.1.78323 WP_001181004.1.78337 WP_001181004.1.78340 WP_001181004.1.78368 WP_001181004.1.78376 WP_001181004.1.78377 WP_001181004.1.78390 WP_001181004.1.784 WP_001181004.1.78413 WP_001181004.1.78445 WP_001181004.1.78453 WP_001181004.1.78462 WP_001181004.1.78463 WP_001181004.1.7847 WP_001181004.1.78477 WP_001181004.1.78481 WP_001181004.1.78491 WP_001181004.1.7851 WP_001181004.1.78512 WP_001181004.1.78515 WP_001181004.1.78523 WP_001181004.1.78527 WP_001181004.1.7855 WP_001181004.1.78553 WP_001181004.1.78572 WP_001181004.1.78575 WP_001181004.1.78581 WP_001181004.1.78583 WP_001181004.1.78586 WP_001181004.1.78593 WP_001181004.1.78610 WP_001181004.1.78611 WP_001181004.1.78612 WP_001181004.1.78615 WP_001181004.1.78622 WP_001181004.1.78645 WP_001181004.1.78677 WP_001181004.1.78683 WP_001181004.1.78687 WP_001181004.1.78689 WP_001181004.1.78696 WP_001181004.1.78698 WP_001181004.1.78706 WP_001181004.1.78714 WP_001181004.1.78718 WP_001181004.1.78746 WP_001181004.1.78750 WP_001181004.1.78757 WP_001181004.1.78773 WP_001181004.1.78775 WP_001181004.1.78791 WP_001181004.1.78814 WP_001181004.1.7883 WP_001181004.1.78843 WP_001181004.1.78845 WP_001181004.1.78854 WP_001181004.1.78888 WP_001181004.1.78891 WP_001181004.1.78893 WP_001181004.1.78895 WP_001181004.1.78908 WP_001181004.1.78919 WP_001181004.1.78953 WP_001181004.1.78955 WP_001181004.1.78956 WP_001181004.1.7896 WP_001181004.1.78966 WP_001181004.1.7898 WP_001181004.1.78996 WP_001181004.1.79001 WP_001181004.1.79002 WP_001181004.1.79004 WP_001181004.1.7901 WP_001181004.1.79065 WP_001181004.1.79067 WP_001181004.1.79075 WP_001181004.1.79086 WP_001181004.1.79088 WP_001181004.1.79090 WP_001181004.1.79092 WP_001181004.1.79100 WP_001181004.1.79126 WP_001181004.1.79137 WP_001181004.1.79159 WP_001181004.1.79172 WP_001181004.1.79226 WP_001181004.1.79233 WP_001181004.1.79243 WP_001181004.1.79246 WP_001181004.1.79248 WP_001181004.1.79249 WP_001181004.1.79276 WP_001181004.1.79306 WP_001181004.1.79308 WP_001181004.1.79312 WP_001181004.1.79342 WP_001181004.1.79343 WP_001181004.1.79346 WP_001181004.1.79348 WP_001181004.1.79356 WP_001181004.1.79365 WP_001181004.1.79368 WP_001181004.1.79369 WP_001181004.1.7937 WP_001181004.1.79389 WP_001181004.1.79391 WP_001181004.1.7940 WP_001181004.1.79409 WP_001181004.1.79414 WP_001181004.1.79416 WP_001181004.1.79443 WP_001181004.1.79464 WP_001181004.1.79478 WP_001181004.1.79505 WP_001181004.1.79519 WP_001181004.1.7952 WP_001181004.1.79525 WP_001181004.1.79528 WP_001181004.1.79540 WP_001181004.1.79558 WP_001181004.1.79563 WP_001181004.1.79576 WP_001181004.1.79591 WP_001181004.1.79606 WP_001181004.1.79619 WP_001181004.1.79640 WP_001181004.1.7967 WP_001181004.1.79685 WP_001181004.1.79707 WP_001181004.1.79713 WP_001181004.1.79715 WP_001181004.1.79749 WP_001181004.1.79759 WP_001181004.1.79764 WP_001181004.1.79800 WP_001181004.1.79816 WP_001181004.1.79824 WP_001181004.1.79866 WP_001181004.1.79869 WP_001181004.1.7987 WP_001181004.1.79871 WP_001181004.1.79877 WP_001181004.1.79905 WP_001181004.1.79922 WP_001181004.1.7993 WP_001181004.1.79930 WP_001181004.1.79931 WP_001181004.1.79932 WP_001181004.1.79933 WP_001181004.1.79936 WP_001181004.1.79944 WP_001181004.1.79952 WP_001181004.1.79955 WP_001181004.1.79965 WP_001181004.1.79973 WP_001181004.1.79984 WP_001181004.1.79995 WP_001181004.1.80 WP_001181004.1.80011 WP_001181004.1.80016 WP_001181004.1.80026 WP_001181004.1.8004 WP_001181004.1.80043 WP_001181004.1.80050 WP_001181004.1.80060 WP_001181004.1.80061 WP_001181004.1.80063 WP_001181004.1.8007 WP_001181004.1.80071 WP_001181004.1.80096 WP_001181004.1.80106 WP_001181004.1.8011 WP_001181004.1.80112 WP_001181004.1.80136 WP_001181004.1.80141 WP_001181004.1.80168 WP_001181004.1.80176 WP_001181004.1.80179 WP_001181004.1.80183 WP_001181004.1.80192 WP_001181004.1.80255 WP_001181004.1.80292 WP_001181004.1.80309 WP_001181004.1.80310 WP_001181004.1.80320 WP_001181004.1.80330 WP_001181004.1.80343 WP_001181004.1.80388 WP_001181004.1.80392 WP_001181004.1.804 WP_001181004.1.80402 WP_001181004.1.80426 WP_001181004.1.80428 WP_001181004.1.80440 WP_001181004.1.80444 WP_001181004.1.80456 WP_001181004.1.80463 WP_001181004.1.80484 WP_001181004.1.80517 WP_001181004.1.80519 WP_001181004.1.80524 WP_001181004.1.80545 WP_001181004.1.80558 WP_001181004.1.80559 WP_001181004.1.8057 WP_001181004.1.80577 WP_001181004.1.80578 WP_001181004.1.80594 WP_001181004.1.80606 WP_001181004.1.80612 WP_001181004.1.80626 WP_001181004.1.80660 WP_001181004.1.80662 WP_001181004.1.80666 WP_001181004.1.80676 WP_001181004.1.8068 WP_001181004.1.80709 WP_001181004.1.80718 WP_001181004.1.80731 WP_001181004.1.80736 WP_001181004.1.80737 WP_001181004.1.8074 WP_001181004.1.80753 WP_001181004.1.80754 WP_001181004.1.80756 WP_001181004.1.8076 WP_001181004.1.80768 WP_001181004.1.80789 WP_001181004.1.808 WP_001181004.1.80804 WP_001181004.1.80805 WP_001181004.1.80843 WP_001181004.1.80862 WP_001181004.1.80882 WP_001181004.1.80884 WP_001181004.1.80894 WP_001181004.1.8090 WP_001181004.1.8091 WP_001181004.1.80935 WP_001181004.1.80945 WP_001181004.1.80946 WP_001181004.1.80948 WP_001181004.1.80954 WP_001181004.1.80966 WP_001181004.1.80983 WP_001181004.1.80985 WP_001181004.1.810 WP_001181004.1.81026 WP_001181004.1.81032 WP_001181004.1.81034 WP_001181004.1.81036 WP_001181004.1.81054 WP_001181004.1.81056 WP_001181004.1.81070 WP_001181004.1.81071 WP_001181004.1.81098 WP_001181004.1.811 WP_001181004.1.81104 WP_001181004.1.81120 WP_001181004.1.81127 WP_001181004.1.81141 WP_001181004.1.81156 WP_001181004.1.81160 WP_001181004.1.81165 WP_001181004.1.8118 WP_001181004.1.81180 WP_001181004.1.81182 WP_001181004.1.81186 WP_001181004.1.8121 WP_001181004.1.81219 WP_001181004.1.81266 WP_001181004.1.81267 WP_001181004.1.81273 WP_001181004.1.81281 WP_001181004.1.81283 WP_001181004.1.81286 WP_001181004.1.8129 WP_001181004.1.81298 WP_001181004.1.81313 WP_001181004.1.81316 WP_001181004.1.81323 WP_001181004.1.81347 WP_001181004.1.81376 WP_001181004.1.81391 WP_001181004.1.81396 WP_001181004.1.814 WP_001181004.1.81418 WP_001181004.1.81420 WP_001181004.1.81423 WP_001181004.1.81438 WP_001181004.1.81442 WP_001181004.1.81469 WP_001181004.1.81475 WP_001181004.1.81484 WP_001181004.1.81514 WP_001181004.1.81517 WP_001181004.1.8156 WP_001181004.1.81576 WP_001181004.1.81577 WP_001181004.1.81580 WP_001181004.1.81582 WP_001181004.1.81588 WP_001181004.1.81589 WP_001181004.1.81596 WP_001181004.1.81602 WP_001181004.1.81618 WP_001181004.1.81624 WP_001181004.1.81625 WP_001181004.1.81688 WP_001181004.1.81692 WP_001181004.1.81715 WP_001181004.1.8172 WP_001181004.1.81723 WP_001181004.1.81739 WP_001181004.1.81754 WP_001181004.1.81761 WP_001181004.1.81806 WP_001181004.1.81819 WP_001181004.1.81821 WP_001181004.1.8183 WP_001181004.1.81832 WP_001181004.1.81843 WP_001181004.1.81869 WP_001181004.1.81873 WP_001181004.1.81876 WP_001181004.1.81881 WP_001181004.1.81888 WP_001181004.1.81914 WP_001181004.1.81934 WP_001181004.1.81935 WP_001181004.1.81939 WP_001181004.1.81952 WP_001181004.1.81956 WP_001181004.1.81972 WP_001181004.1.81975 WP_001181004.1.82 WP_001181004.1.82008 WP_001181004.1.82010 WP_001181004.1.82032 WP_001181004.1.82057 WP_001181004.1.82059 WP_001181004.1.82061 WP_001181004.1.82062 WP_001181004.1.82074 WP_001181004.1.82095 WP_001181004.1.82104 WP_001181004.1.82106 WP_001181004.1.82116 WP_001181004.1.82123 WP_001181004.1.82137 WP_001181004.1.82166 WP_001181004.1.82217 WP_001181004.1.82221 WP_001181004.1.82239 WP_001181004.1.82240 WP_001181004.1.82242 WP_001181004.1.82246 WP_001181004.1.82275 WP_001181004.1.82280 WP_001181004.1.82296 WP_001181004.1.82316 WP_001181004.1.82320 WP_001181004.1.82326 WP_001181004.1.82330 WP_001181004.1.8235 WP_001181004.1.82378 WP_001181004.1.82438 WP_001181004.1.82439 WP_001181004.1.82485 WP_001181004.1.82499 WP_001181004.1.82507 WP_001181004.1.82514 WP_001181004.1.82527 WP_001181004.1.82536 WP_001181004.1.82539 WP_001181004.1.8255 WP_001181004.1.82572 WP_001181004.1.82589 WP_001181004.1.82594 WP_001181004.1.82614 WP_001181004.1.82626 WP_001181004.1.82629 WP_001181004.1.82647 WP_001181004.1.82661 WP_001181004.1.8268 WP_001181004.1.82682 WP_001181004.1.82691 WP_001181004.1.82698 WP_001181004.1.82700 WP_001181004.1.82705 WP_001181004.1.82711 WP_001181004.1.82715 WP_001181004.1.82718 WP_001181004.1.82747 WP_001181004.1.82754 WP_001181004.1.8277 WP_001181004.1.82776 WP_001181004.1.82780 WP_001181004.1.82784 WP_001181004.1.82797 WP_001181004.1.82799 WP_001181004.1.82808 WP_001181004.1.82816 WP_001181004.1.82820 WP_001181004.1.82831 WP_001181004.1.82833 WP_001181004.1.82853 WP_001181004.1.82901 WP_001181004.1.82902 WP_001181004.1.82923 WP_001181004.1.8295 WP_001181004.1.82991 WP_001181004.1.83020 WP_001181004.1.83033 WP_001181004.1.83035 WP_001181004.1.83036 WP_001181004.1.83051 WP_001181004.1.83059 WP_001181004.1.8306 WP_001181004.1.8308 WP_001181004.1.83093 WP_001181004.1.83097 WP_001181004.1.83099 WP_001181004.1.831 WP_001181004.1.83118 WP_001181004.1.83125 WP_001181004.1.83127 WP_001181004.1.83140 WP_001181004.1.83144 WP_001181004.1.83151 WP_001181004.1.83160 WP_001181004.1.83177 WP_001181004.1.83205 WP_001181004.1.83214 WP_001181004.1.83218 WP_001181004.1.83224 WP_001181004.1.83238 WP_001181004.1.83253 WP_001181004.1.83256 WP_001181004.1.83286 WP_001181004.1.83313 WP_001181004.1.83321 WP_001181004.1.83330 WP_001181004.1.83347 WP_001181004.1.83375 WP_001181004.1.83384 WP_001181004.1.83393 WP_001181004.1.83415 WP_001181004.1.8345 WP_001181004.1.83466 WP_001181004.1.83481 WP_001181004.1.83506 WP_001181004.1.83537 WP_001181004.1.83544 WP_001181004.1.83564 WP_001181004.1.83582 WP_001181004.1.83584 WP_001181004.1.83644 WP_001181004.1.83660 WP_001181004.1.83668 WP_001181004.1.8368 WP_001181004.1.83684 WP_001181004.1.83706 WP_001181004.1.83712 WP_001181004.1.83735 WP_001181004.1.83762 WP_001181004.1.83781 WP_001181004.1.83807 WP_001181004.1.83820 WP_001181004.1.8384 WP_001181004.1.8386 WP_001181004.1.83879 WP_001181004.1.83911 WP_001181004.1.83936 WP_001181004.1.83941 WP_001181004.1.83947 WP_001181004.1.84004 WP_001181004.1.84014 WP_001181004.1.84021 WP_001181004.1.8405 WP_001181004.1.84059 WP_001181004.1.84060 WP_001181004.1.84074 WP_001181004.1.8408 WP_001181004.1.8411 WP_001181004.1.84140 WP_001181004.1.84164 WP_001181004.1.84172 WP_001181004.1.84185 WP_001181004.1.84197 WP_001181004.1.84210 WP_001181004.1.84215 WP_001181004.1.84219 WP_001181004.1.84221 WP_001181004.1.84264 WP_001181004.1.84298 WP_001181004.1.84312 WP_001181004.1.84313 WP_001181004.1.84316 WP_001181004.1.84319 WP_001181004.1.84326 WP_001181004.1.84331 WP_001181004.1.84339 WP_001181004.1.84348 WP_001181004.1.84402 WP_001181004.1.84405 WP_001181004.1.84410 WP_001181004.1.84436 WP_001181004.1.8444 WP_001181004.1.84462 WP_001181004.1.84464 WP_001181004.1.84467 WP_001181004.1.8447 WP_001181004.1.84473 WP_001181004.1.84476 WP_001181004.1.84482 WP_001181004.1.84484 WP_001181004.1.84486 WP_001181004.1.84511 WP_001181004.1.84518 WP_001181004.1.84531 WP_001181004.1.84534 WP_001181004.1.84584 WP_001181004.1.84635 WP_001181004.1.84639 WP_001181004.1.84656 WP_001181004.1.84657 WP_001181004.1.84668 WP_001181004.1.84675 WP_001181004.1.84697 WP_001181004.1.8470 WP_001181004.1.84731 WP_001181004.1.84738 WP_001181004.1.84740 WP_001181004.1.84768 WP_001181004.1.8477 WP_001181004.1.84784 WP_001181004.1.84797 WP_001181004.1.84841 WP_001181004.1.84850 WP_001181004.1.84875 WP_001181004.1.84877 WP_001181004.1.84878 WP_001181004.1.84881 WP_001181004.1.84893 WP_001181004.1.84894 WP_001181004.1.84916 WP_001181004.1.84929 WP_001181004.1.84941 WP_001181004.1.84948 WP_001181004.1.84966 WP_001181004.1.84972 WP_001181004.1.84977 WP_001181004.1.84986 WP_001181004.1.84989 WP_001181004.1.84990 WP_001181004.1.84994 WP_001181004.1.85002 WP_001181004.1.85011 WP_001181004.1.85025 WP_001181004.1.85048 WP_001181004.1.85052 WP_001181004.1.85077 WP_001181004.1.85085 WP_001181004.1.85090 WP_001181004.1.85098 WP_001181004.1.85105 WP_001181004.1.85106 WP_001181004.1.85112 WP_001181004.1.85125 WP_001181004.1.85129 WP_001181004.1.85138 WP_001181004.1.85141 WP_001181004.1.85156 WP_001181004.1.8517 WP_001181004.1.85175 WP_001181004.1.85188 WP_001181004.1.85216 WP_001181004.1.85241 WP_001181004.1.85247 WP_001181004.1.85252 WP_001181004.1.85253 WP_001181004.1.85255 WP_001181004.1.85260 WP_001181004.1.8530 WP_001181004.1.85305 WP_001181004.1.85310 WP_001181004.1.85315 WP_001181004.1.85320 WP_001181004.1.85323 WP_001181004.1.85329 WP_001181004.1.85335 WP_001181004.1.85336 WP_001181004.1.85342 WP_001181004.1.85361 WP_001181004.1.85369 WP_001181004.1.85384 WP_001181004.1.85385 WP_001181004.1.85416 WP_001181004.1.85435 WP_001181004.1.85500 WP_001181004.1.85504 WP_001181004.1.85525 WP_001181004.1.85546 WP_001181004.1.85554 WP_001181004.1.85556 WP_001181004.1.85558 WP_001181004.1.85563 WP_001181004.1.85578 WP_001181004.1.85593 WP_001181004.1.8560 WP_001181004.1.85601 WP_001181004.1.85621 WP_001181004.1.85623 WP_001181004.1.8564 WP_001181004.1.85657 WP_001181004.1.85685 WP_001181004.1.85722 WP_001181004.1.85752 WP_001181004.1.85762 WP_001181004.1.85767 WP_001181004.1.85772 WP_001181004.1.85773 WP_001181004.1.85781 WP_001181004.1.8579 WP_001181004.1.85793 WP_001181004.1.85800 WP_001181004.1.85806 WP_001181004.1.8582 WP_001181004.1.85857 WP_001181004.1.85895 WP_001181004.1.8592 WP_001181004.1.85939 WP_001181004.1.85944 WP_001181004.1.85948 WP_001181004.1.85969 WP_001181004.1.86 WP_001181004.1.86001 WP_001181004.1.86016 WP_001181004.1.8603 WP_001181004.1.86035 WP_001181004.1.86063 WP_001181004.1.8607 WP_001181004.1.86104 WP_001181004.1.86105 WP_001181004.1.86110 WP_001181004.1.86115 WP_001181004.1.86145 WP_001181004.1.86149 WP_001181004.1.86161 WP_001181004.1.86166 WP_001181004.1.86171 WP_001181004.1.86176 WP_001181004.1.86179 WP_001181004.1.86181 WP_001181004.1.86189 WP_001181004.1.86196 WP_001181004.1.8621 WP_001181004.1.86210 WP_001181004.1.86225 WP_001181004.1.86227 WP_001181004.1.86228 WP_001181004.1.86234 WP_001181004.1.86255 WP_001181004.1.86261 WP_001181004.1.86263 WP_001181004.1.86266 WP_001181004.1.86273 WP_001181004.1.86276 WP_001181004.1.86280 WP_001181004.1.86283 WP_001181004.1.86294 WP_001181004.1.86340 WP_001181004.1.8635 WP_001181004.1.86353 WP_001181004.1.86355 WP_001181004.1.86364 WP_001181004.1.86371 WP_001181004.1.86376 WP_001181004.1.86393 WP_001181004.1.86411 WP_001181004.1.86412 WP_001181004.1.86437 WP_001181004.1.86451 WP_001181004.1.86452 WP_001181004.1.86454 WP_001181004.1.86461 WP_001181004.1.86475 WP_001181004.1.86483 WP_001181004.1.86492 WP_001181004.1.86518 WP_001181004.1.8652 WP_001181004.1.8656 WP_001181004.1.86560 WP_001181004.1.86574 WP_001181004.1.86583 WP_001181004.1.86586 WP_001181004.1.86598 WP_001181004.1.86609 WP_001181004.1.86613 WP_001181004.1.86617 WP_001181004.1.86627 WP_001181004.1.86640 WP_001181004.1.86667 WP_001181004.1.86673 WP_001181004.1.86674 WP_001181004.1.86681 WP_001181004.1.86691 WP_001181004.1.86707 WP_001181004.1.86717 WP_001181004.1.86727 WP_001181004.1.86731 WP_001181004.1.86734 WP_001181004.1.86753 WP_001181004.1.86760 WP_001181004.1.86768 WP_001181004.1.86787 WP_001181004.1.86788 WP_001181004.1.8679 WP_001181004.1.86833 WP_001181004.1.86846 WP_001181004.1.86848 WP_001181004.1.8687 WP_001181004.1.86934 WP_001181004.1.86935 WP_001181004.1.86956 WP_001181004.1.86959 WP_001181004.1.86975 WP_001181004.1.86994 WP_001181004.1.86997 WP_001181004.1.87043 WP_001181004.1.8705 WP_001181004.1.87059 WP_001181004.1.87067 WP_001181004.1.87074 WP_001181004.1.87075 WP_001181004.1.87076 WP_001181004.1.87102 WP_001181004.1.87109 WP_001181004.1.8711 WP_001181004.1.87147 WP_001181004.1.87177 WP_001181004.1.87189 WP_001181004.1.87199 WP_001181004.1.87205 WP_001181004.1.87247 WP_001181004.1.87249 WP_001181004.1.87254 WP_001181004.1.87310 WP_001181004.1.87339 WP_001181004.1.87358 WP_001181004.1.87371 WP_001181004.1.87382 WP_001181004.1.87389 WP_001181004.1.87400 WP_001181004.1.87410 WP_001181004.1.87443 WP_001181004.1.87465 WP_001181004.1.87491 WP_001181004.1.87504 WP_001181004.1.87557 WP_001181004.1.87563 WP_001181004.1.87568 WP_001181004.1.87574 WP_001181004.1.87581 WP_001181004.1.87590 WP_001181004.1.87607 WP_001181004.1.87608 WP_001181004.1.87610 WP_001181004.1.87616 WP_001181004.1.87633 WP_001181004.1.87635 WP_001181004.1.87639 WP_001181004.1.87655 WP_001181004.1.87675 WP_001181004.1.87694 WP_001181004.1.87696 WP_001181004.1.8771 WP_001181004.1.87721 WP_001181004.1.87726 WP_001181004.1.87728 WP_001181004.1.87733 WP_001181004.1.87738 WP_001181004.1.87766 WP_001181004.1.8778 WP_001181004.1.87786 WP_001181004.1.87788 WP_001181004.1.87789 WP_001181004.1.87822 WP_001181004.1.87834 WP_001181004.1.87857 WP_001181004.1.87883 WP_001181004.1.87914 WP_001181004.1.87919 WP_001181004.1.87973 WP_001181004.1.87976 WP_001181004.1.87980 WP_001181004.1.87984 WP_001181004.1.87989 WP_001181004.1.87990 WP_001181004.1.880 WP_001181004.1.88017 WP_001181004.1.88020 WP_001181004.1.88066 WP_001181004.1.8807 WP_001181004.1.88082 WP_001181004.1.88088 WP_001181004.1.88110 WP_001181004.1.88119 WP_001181004.1.88147 WP_001181004.1.88149 WP_001181004.1.88155 WP_001181004.1.88189 WP_001181004.1.88197 WP_001181004.1.8822 WP_001181004.1.88234 WP_001181004.1.88238 WP_001181004.1.88252 WP_001181004.1.88260 WP_001181004.1.88263 WP_001181004.1.88285 WP_001181004.1.88301 WP_001181004.1.88304 WP_001181004.1.88336 WP_001181004.1.88352 WP_001181004.1.88376 WP_001181004.1.88379 WP_001181004.1.88384 WP_001181004.1.88413 WP_001181004.1.88427 WP_001181004.1.8843 WP_001181004.1.88434 WP_001181004.1.88438 WP_001181004.1.88462 WP_001181004.1.88467 WP_001181004.1.8848 WP_001181004.1.88499 WP_001181004.1.88505 WP_001181004.1.88524 WP_001181004.1.88527 WP_001181004.1.88528 WP_001181004.1.88535 WP_001181004.1.88539 WP_001181004.1.8854 WP_001181004.1.8855 WP_001181004.1.88557 WP_001181004.1.88562 WP_001181004.1.88577 WP_001181004.1.88598 WP_001181004.1.88603 WP_001181004.1.88607 WP_001181004.1.88631 WP_001181004.1.88646 WP_001181004.1.88667 WP_001181004.1.88678 WP_001181004.1.88685 WP_001181004.1.88686 WP_001181004.1.88709 WP_001181004.1.88710 WP_001181004.1.88711 WP_001181004.1.88717 WP_001181004.1.88720 WP_001181004.1.88729 WP_001181004.1.8873 WP_001181004.1.88732 WP_001181004.1.88735 WP_001181004.1.88752 WP_001181004.1.88757 WP_001181004.1.88759 WP_001181004.1.88767 WP_001181004.1.8879 WP_001181004.1.88793 WP_001181004.1.88803 WP_001181004.1.88826 WP_001181004.1.88834 WP_001181004.1.88864 WP_001181004.1.88880 WP_001181004.1.88883 WP_001181004.1.88891 WP_001181004.1.88941 WP_001181004.1.88950 WP_001181004.1.88953 WP_001181004.1.88961 WP_001181004.1.88997 WP_001181004.1.89018 WP_001181004.1.89043 WP_001181004.1.89050 WP_001181004.1.8906 WP_001181004.1.89067 WP_001181004.1.89069 WP_001181004.1.89090 WP_001181004.1.89097 WP_001181004.1.89099 WP_001181004.1.89111 WP_001181004.1.89150 WP_001181004.1.89163 WP_001181004.1.89165 WP_001181004.1.89183 WP_001181004.1.89197 WP_001181004.1.89200 WP_001181004.1.89203 WP_001181004.1.89214 WP_001181004.1.89217 WP_001181004.1.89255 WP_001181004.1.8928 WP_001181004.1.89285 WP_001181004.1.89305 WP_001181004.1.89312 WP_001181004.1.89322 WP_001181004.1.89334 WP_001181004.1.89335 WP_001181004.1.89351 WP_001181004.1.89379 WP_001181004.1.8938 WP_001181004.1.89385 WP_001181004.1.89396 WP_001181004.1.894 WP_001181004.1.89400 WP_001181004.1.89403 WP_001181004.1.89405 WP_001181004.1.89416 WP_001181004.1.89427 WP_001181004.1.89432 WP_001181004.1.8945 WP_001181004.1.89455 WP_001181004.1.89458 WP_001181004.1.89466 WP_001181004.1.89468 WP_001181004.1.89469 WP_001181004.1.89474 WP_001181004.1.89479 WP_001181004.1.89492 WP_001181004.1.89496 WP_001181004.1.89510 WP_001181004.1.89551 WP_001181004.1.89569 WP_001181004.1.89583 WP_001181004.1.89601 WP_001181004.1.89605 WP_001181004.1.89627 WP_001181004.1.89630 WP_001181004.1.89631 WP_001181004.1.89646 WP_001181004.1.89656 WP_001181004.1.89674 WP_001181004.1.89679 WP_001181004.1.89700 WP_001181004.1.89710 WP_001181004.1.89745 WP_001181004.1.89747 WP_001181004.1.89768 WP_001181004.1.89781 WP_001181004.1.89788 WP_001181004.1.89818 WP_001181004.1.89839 WP_001181004.1.89841 WP_001181004.1.8985 WP_001181004.1.89852 WP_001181004.1.89879 WP_001181004.1.89895 WP_001181004.1.89899 WP_001181004.1.89915 WP_001181004.1.89917 WP_001181004.1.89918 WP_001181004.1.89920 WP_001181004.1.89923 WP_001181004.1.89925 WP_001181004.1.89927 WP_001181004.1.89959 WP_001181004.1.89977 WP_001181004.1.89988 WP_001181004.1.89998 WP_001181004.1.90017 WP_001181004.1.90022 WP_001181004.1.90050 WP_001181004.1.90063 WP_001181004.1.90065 WP_001181004.1.90078 WP_001181004.1.9009 WP_001181004.1.9010 WP_001181004.1.90115 WP_001181004.1.90128 WP_001181004.1.90139 WP_001181004.1.90146 WP_001181004.1.90156 WP_001181004.1.90168 WP_001181004.1.90171 WP_001181004.1.90182 WP_001181004.1.902 WP_001181004.1.90205 WP_001181004.1.90219 WP_001181004.1.90249 WP_001181004.1.90256 WP_001181004.1.90257 WP_001181004.1.90266 WP_001181004.1.90270 WP_001181004.1.90314 WP_001181004.1.90315 WP_001181004.1.90332 WP_001181004.1.90342 WP_001181004.1.90346 WP_001181004.1.90349 WP_001181004.1.90357 WP_001181004.1.90358 WP_001181004.1.9036 WP_001181004.1.9037 WP_001181004.1.90389 WP_001181004.1.90405 WP_001181004.1.90435 WP_001181004.1.90436 WP_001181004.1.90441 WP_001181004.1.90449 WP_001181004.1.90467 WP_001181004.1.90511 WP_001181004.1.90520 WP_001181004.1.90525 WP_001181004.1.90536 WP_001181004.1.90542 WP_001181004.1.90547 WP_001181004.1.9059 WP_001181004.1.90591 WP_001181004.1.90602 WP_001181004.1.9061 WP_001181004.1.90626 WP_001181004.1.90690 WP_001181004.1.90703 WP_001181004.1.90706 WP_001181004.1.90758 WP_001181004.1.90775 WP_001181004.1.90799 WP_001181004.1.9081 WP_001181004.1.90813 WP_001181004.1.90822 WP_001181004.1.90828 WP_001181004.1.90834 WP_001181004.1.90837 WP_001181004.1.90839 WP_001181004.1.9084 WP_001181004.1.90842 WP_001181004.1.90844 WP_001181004.1.90848 WP_001181004.1.90856 WP_001181004.1.90864 WP_001181004.1.90865 WP_001181004.1.9087 WP_001181004.1.90873 WP_001181004.1.90890 WP_001181004.1.909 WP_001181004.1.90905 WP_001181004.1.90924 WP_001181004.1.90951 WP_001181004.1.90960 WP_001181004.1.90967 WP_001181004.1.90979 WP_001181004.1.9098 WP_001181004.1.90988 WP_001181004.1.90996 WP_001181004.1.90997 WP_001181004.1.91 WP_001181004.1.91007 WP_001181004.1.91010 WP_001181004.1.91018 WP_001181004.1.9104 WP_001181004.1.91072 WP_001181004.1.91088 WP_001181004.1.91094 WP_001181004.1.91113 WP_001181004.1.91117 WP_001181004.1.91121 WP_001181004.1.91138 WP_001181004.1.91143 WP_001181004.1.91153 WP_001181004.1.91170 WP_001181004.1.9118 WP_001181004.1.91182 WP_001181004.1.9119 WP_001181004.1.91213 WP_001181004.1.91220 WP_001181004.1.91266 WP_001181004.1.91268 WP_001181004.1.91277 WP_001181004.1.91288 WP_001181004.1.91290 WP_001181004.1.91340 WP_001181004.1.91341 WP_001181004.1.91354 WP_001181004.1.91356 WP_001181004.1.91361 WP_001181004.1.91377 WP_001181004.1.91384 WP_001181004.1.91397 WP_001181004.1.91414 WP_001181004.1.91425 WP_001181004.1.91445 WP_001181004.1.91462 WP_001181004.1.91482 WP_001181004.1.91485 WP_001181004.1.91494 WP_001181004.1.915 WP_001181004.1.91511 WP_001181004.1.91515 WP_001181004.1.91516 WP_001181004.1.91526 WP_001181004.1.91543 WP_001181004.1.91548 WP_001181004.1.91549 WP_001181004.1.91551 WP_001181004.1.91565 WP_001181004.1.91566 WP_001181004.1.9157 WP_001181004.1.91594 WP_001181004.1.91596 WP_001181004.1.9160 WP_001181004.1.91626 WP_001181004.1.91630 WP_001181004.1.91640 WP_001181004.1.91643 WP_001181004.1.91644 WP_001181004.1.91651 WP_001181004.1.91666 WP_001181004.1.91672 WP_001181004.1.9168 WP_001181004.1.91685 WP_001181004.1.9169 WP_001181004.1.91701 WP_001181004.1.9171 WP_001181004.1.91739 WP_001181004.1.91756 WP_001181004.1.91777 WP_001181004.1.91779 WP_001181004.1.91782 WP_001181004.1.91787 WP_001181004.1.91793 WP_001181004.1.91801 WP_001181004.1.91814 WP_001181004.1.91843 WP_001181004.1.9185 WP_001181004.1.91850 WP_001181004.1.91863 WP_001181004.1.91871 WP_001181004.1.91879 WP_001181004.1.91887 WP_001181004.1.91893 WP_001181004.1.91894 WP_001181004.1.91951 WP_001181004.1.91954 WP_001181004.1.91959 WP_001181004.1.91965 WP_001181004.1.91971 WP_001181004.1.9199 WP_001181004.1.91994 WP_001181004.1.92005 WP_001181004.1.92014 WP_001181004.1.92019 WP_001181004.1.92025 WP_001181004.1.92029 WP_001181004.1.92031 WP_001181004.1.92048 WP_001181004.1.92053 WP_001181004.1.92058 WP_001181004.1.9209 WP_001181004.1.92096 WP_001181004.1.921 WP_001181004.1.92102 WP_001181004.1.92114 WP_001181004.1.92123 WP_001181004.1.9215 WP_001181004.1.92161 WP_001181004.1.92163 WP_001181004.1.92180 WP_001181004.1.92195 WP_001181004.1.92201 WP_001181004.1.92215 WP_001181004.1.92224 WP_001181004.1.92276 WP_001181004.1.92295 WP_001181004.1.92304 WP_001181004.1.92305 WP_001181004.1.92311 WP_001181004.1.92323 WP_001181004.1.92361 WP_001181004.1.92384 WP_001181004.1.924 WP_001181004.1.92403 WP_001181004.1.92434 WP_001181004.1.92462 WP_001181004.1.92473 WP_001181004.1.92495 WP_001181004.1.92496 WP_001181004.1.92506 WP_001181004.1.92532 WP_001181004.1.92535 WP_001181004.1.9255 WP_001181004.1.92568 WP_001181004.1.92571 WP_001181004.1.92577 WP_001181004.1.92614 WP_001181004.1.92615 WP_001181004.1.92634 WP_001181004.1.92638 WP_001181004.1.9264 WP_001181004.1.92648 WP_001181004.1.9266 WP_001181004.1.92668 WP_001181004.1.92693 WP_001181004.1.92708 WP_001181004.1.92719 WP_001181004.1.92742 WP_001181004.1.92750 WP_001181004.1.92767 WP_001181004.1.92780 WP_001181004.1.92781 WP_001181004.1.92792 WP_001181004.1.92793 WP_001181004.1.92796 WP_001181004.1.92819 WP_001181004.1.92845 WP_001181004.1.92865 WP_001181004.1.92882 WP_001181004.1.92886 WP_001181004.1.92932 WP_001181004.1.92943 WP_001181004.1.92953 WP_001181004.1.92989 WP_001181004.1.92991 WP_001181004.1.93005 WP_001181004.1.93016 WP_001181004.1.93017 WP_001181004.1.93019 WP_001181004.1.93023 WP_001181004.1.93027 WP_001181004.1.93033 WP_001181004.1.93048 WP_001181004.1.93052 WP_001181004.1.93054 WP_001181004.1.93069 WP_001181004.1.93072 WP_001181004.1.93085 WP_001181004.1.93100 WP_001181004.1.93112 WP_001181004.1.93133 WP_001181004.1.93138 WP_001181004.1.93139 WP_001181004.1.93150 WP_001181004.1.93167 WP_001181004.1.93185 WP_001181004.1.93233 WP_001181004.1.93252 WP_001181004.1.93267 WP_001181004.1.9327 WP_001181004.1.93276 WP_001181004.1.93291 WP_001181004.1.93309 WP_001181004.1.9331 WP_001181004.1.93312 WP_001181004.1.93326 WP_001181004.1.93338 WP_001181004.1.93379 WP_001181004.1.93388 WP_001181004.1.934 WP_001181004.1.93427 WP_001181004.1.93428 WP_001181004.1.93431 WP_001181004.1.93453 WP_001181004.1.93461 WP_001181004.1.93463 WP_001181004.1.93464 WP_001181004.1.93468 WP_001181004.1.93509 WP_001181004.1.93531 WP_001181004.1.93533 WP_001181004.1.93552 WP_001181004.1.9356 WP_001181004.1.93601 WP_001181004.1.93605 WP_001181004.1.93621 WP_001181004.1.93626 WP_001181004.1.93629 WP_001181004.1.93630 WP_001181004.1.93634 WP_001181004.1.93637 WP_001181004.1.93639 WP_001181004.1.93652 WP_001181004.1.93665 WP_001181004.1.93670 WP_001181004.1.93673 WP_001181004.1.93679 WP_001181004.1.93694 WP_001181004.1.93695 WP_001181004.1.93716 WP_001181004.1.93733 WP_001181004.1.93737 WP_001181004.1.93742 WP_001181004.1.93743 WP_001181004.1.93745 WP_001181004.1.93755 WP_001181004.1.93765 WP_001181004.1.93768 WP_001181004.1.938 WP_001181004.1.93800 WP_001181004.1.93821 WP_001181004.1.93870 WP_001181004.1.93873 WP_001181004.1.93877 WP_001181004.1.939 WP_001181004.1.93900 WP_001181004.1.93911 WP_001181004.1.93918 WP_001181004.1.93921 WP_001181004.1.93922 WP_001181004.1.93939 WP_001181004.1.93951 WP_001181004.1.93952 WP_001181004.1.93971 WP_001181004.1.94008 WP_001181004.1.94011 WP_001181004.1.94025 WP_001181004.1.94028 WP_001181004.1.94035 WP_001181004.1.94040 WP_001181004.1.94057 WP_001181004.1.94069 WP_001181004.1.94156 WP_001181004.1.9416 WP_001181004.1.94176 WP_001181004.1.94187 WP_001181004.1.94190 WP_001181004.1.9420 WP_001181004.1.94213 WP_001181004.1.94232 WP_001181004.1.9426 WP_001181004.1.94271 WP_001181004.1.94282 WP_001181004.1.94298 WP_001181004.1.94302 WP_001181004.1.94317 WP_001181004.1.94343 WP_001181004.1.94353 WP_001181004.1.94367 WP_001181004.1.94388 WP_001181004.1.94404 WP_001181004.1.94417 WP_001181004.1.94429 WP_001181004.1.94430 WP_001181004.1.94436 WP_001181004.1.94438 WP_001181004.1.94445 WP_001181004.1.94446 WP_001181004.1.94468 WP_001181004.1.94475 WP_001181004.1.94497 WP_001181004.1.94507 WP_001181004.1.94516 WP_001181004.1.94523 WP_001181004.1.94542 WP_001181004.1.94544 WP_001181004.1.94548 WP_001181004.1.9457 WP_001181004.1.94578 WP_001181004.1.94580 WP_001181004.1.94589 WP_001181004.1.94619 WP_001181004.1.94626 WP_001181004.1.94646 WP_001181004.1.94653 WP_001181004.1.94676 WP_001181004.1.94686 WP_001181004.1.94690 WP_001181004.1.94692 WP_001181004.1.94695 WP_001181004.1.94704 WP_001181004.1.94727 WP_001181004.1.94738 WP_001181004.1.94739 WP_001181004.1.9474 WP_001181004.1.94753 WP_001181004.1.94754 WP_001181004.1.94764 WP_001181004.1.94787 WP_001181004.1.94790 WP_001181004.1.948 WP_001181004.1.94801 WP_001181004.1.94806 WP_001181004.1.94808 WP_001181004.1.94822 WP_001181004.1.94823 WP_001181004.1.94836 WP_001181004.1.94841 WP_001181004.1.94847 WP_001181004.1.94869 WP_001181004.1.94877 WP_001181004.1.94880 WP_001181004.1.94889 WP_001181004.1.9489 WP_001181004.1.94892 WP_001181004.1.94898 WP_001181004.1.949 WP_001181004.1.94903 WP_001181004.1.94907 WP_001181004.1.9491 WP_001181004.1.94927 WP_001181004.1.94934 WP_001181004.1.94935 WP_001181004.1.94938 WP_001181004.1.94949 WP_001181004.1.94955 WP_001181004.1.94963 WP_001181004.1.94991 WP_001181004.1.94993 WP_001181004.1.94997 WP_001181004.1.95005 WP_001181004.1.95011 WP_001181004.1.95022 WP_001181004.1.95028 WP_001181004.1.95035 WP_001181004.1.95036 WP_001181004.1.95037 WP_001181004.1.95062 WP_001181004.1.95080 WP_001181004.1.95084 WP_001181004.1.95105 WP_001181004.1.95129 WP_001181004.1.9513 WP_001181004.1.95161 WP_001181004.1.95198 WP_001181004.1.95233 WP_001181004.1.95243 WP_001181004.1.95244 WP_001181004.1.95254 WP_001181004.1.95275 WP_001181004.1.95310 WP_001181004.1.95329 WP_001181004.1.95332 WP_001181004.1.95364 WP_001181004.1.95366 WP_001181004.1.95368 WP_001181004.1.95378 WP_001181004.1.95381 WP_001181004.1.95390 WP_001181004.1.95395 WP_001181004.1.95398 WP_001181004.1.95400 WP_001181004.1.95403 WP_001181004.1.95424 WP_001181004.1.95428 WP_001181004.1.95431 WP_001181004.1.95438 WP_001181004.1.95449 WP_001181004.1.95490 WP_001181004.1.95518 WP_001181004.1.95521 WP_001181004.1.95563 WP_001181004.1.9559 WP_001181004.1.95595 WP_001181004.1.95596 WP_001181004.1.95604 WP_001181004.1.95611 WP_001181004.1.95628 WP_001181004.1.95634 WP_001181004.1.95655 WP_001181004.1.9566 WP_001181004.1.95666 WP_001181004.1.95680 WP_001181004.1.95712 WP_001181004.1.95756 WP_001181004.1.95759 WP_001181004.1.95771 WP_001181004.1.95783 WP_001181004.1.95784 WP_001181004.1.95800 WP_001181004.1.95801 WP_001181004.1.95821 WP_001181004.1.95824 WP_001181004.1.95827 WP_001181004.1.95834 WP_001181004.1.95835 WP_001181004.1.95846 WP_001181004.1.95849 WP_001181004.1.95858 WP_001181004.1.95861 WP_001181004.1.95865 WP_001181004.1.95869 WP_001181004.1.95916 WP_001181004.1.95919 WP_001181004.1.95929 WP_001181004.1.95931 WP_001181004.1.95932 WP_001181004.1.95951 WP_001181004.1.960 WP_001181004.1.96015 WP_001181004.1.96032 WP_001181004.1.96053 WP_001181004.1.96059 WP_001181004.1.96066 WP_001181004.1.96086 WP_001181004.1.96097 WP_001181004.1.96110 WP_001181004.1.96114 WP_001181004.1.96128 WP_001181004.1.96143 WP_001181004.1.96145 WP_001181004.1.9616 WP_001181004.1.96177 WP_001181004.1.96215 WP_001181004.1.96222 WP_001181004.1.96223 WP_001181004.1.96229 WP_001181004.1.96247 WP_001181004.1.96253 WP_001181004.1.96263 WP_001181004.1.96278 WP_001181004.1.96279 WP_001181004.1.96281 WP_001181004.1.96290 WP_001181004.1.96293 WP_001181004.1.96299 WP_001181004.1.96303 WP_001181004.1.9631 WP_001181004.1.96339 WP_001181004.1.96341 WP_001181004.1.96378 WP_001181004.1.96392 WP_001181004.1.96394 WP_001181004.1.9641 WP_001181004.1.96417 WP_001181004.1.96420 WP_001181004.1.96425 WP_001181004.1.96450 WP_001181004.1.96457 WP_001181004.1.96478 WP_001181004.1.96479 WP_001181004.1.96480 WP_001181004.1.96484 WP_001181004.1.9649 WP_001181004.1.965 WP_001181004.1.96519 WP_001181004.1.96541 WP_001181004.1.96558 WP_001181004.1.96562 WP_001181004.1.9657 WP_001181004.1.96585 WP_001181004.1.96608 WP_001181004.1.96609 WP_001181004.1.9661 WP_001181004.1.96617 WP_001181004.1.96633 WP_001181004.1.96650 WP_001181004.1.96659 WP_001181004.1.96676 WP_001181004.1.9668 WP_001181004.1.96680 WP_001181004.1.96683 WP_001181004.1.96695 WP_001181004.1.96701 WP_001181004.1.9671 WP_001181004.1.96725 WP_001181004.1.96743 WP_001181004.1.96753 WP_001181004.1.96759 WP_001181004.1.96762 WP_001181004.1.96769 WP_001181004.1.96779 WP_001181004.1.96796 WP_001181004.1.96797 WP_001181004.1.96817 WP_001181004.1.9682 WP_001181004.1.96820 WP_001181004.1.96850 WP_001181004.1.96864 WP_001181004.1.96894 WP_001181004.1.9690 WP_001181004.1.96907 WP_001181004.1.9691 WP_001181004.1.96924 WP_001181004.1.96932 WP_001181004.1.96936 WP_001181004.1.96944 WP_001181004.1.96971 WP_001181004.1.96984 WP_001181004.1.96989 WP_001181004.1.97011 WP_001181004.1.97027 WP_001181004.1.97049 WP_001181004.1.97059 WP_001181004.1.9708 WP_001181004.1.97119 WP_001181004.1.97123 WP_001181004.1.97147 WP_001181004.1.97170 WP_001181004.1.97193 WP_001181004.1.97195 WP_001181004.1.97200 WP_001181004.1.97226 WP_001181004.1.9723 WP_001181004.1.97231 WP_001181004.1.97238 WP_001181004.1.97247 WP_001181004.1.97248 WP_001181004.1.97269 WP_001181004.1.97279 WP_001181004.1.97282 WP_001181004.1.9729 WP_001181004.1.97292 WP_001181004.1.97344 WP_001181004.1.97351 WP_001181004.1.97356 WP_001181004.1.97360 WP_001181004.1.97361 WP_001181004.1.97379 WP_001181004.1.97387 WP_001181004.1.9740 WP_001181004.1.97402 WP_001181004.1.97418 WP_001181004.1.97421 WP_001181004.1.97434 WP_001181004.1.97437 WP_001181004.1.97439 WP_001181004.1.97459 WP_001181004.1.97464 WP_001181004.1.9747 WP_001181004.1.97490 WP_001181004.1.97502 WP_001181004.1.97513 WP_001181004.1.97525 WP_001181004.1.97527 WP_001181004.1.97538 WP_001181004.1.97544 WP_001181004.1.97549 WP_001181004.1.97560 WP_001181004.1.97571 WP_001181004.1.97619 WP_001181004.1.97632 WP_001181004.1.97654 WP_001181004.1.97667 WP_001181004.1.97675 WP_001181004.1.97677 WP_001181004.1.97685 WP_001181004.1.9770 WP_001181004.1.97705 WP_001181004.1.97711 WP_001181004.1.97770 WP_001181004.1.97775 WP_001181004.1.97778 WP_001181004.1.97789 WP_001181004.1.97798 WP_001181004.1.978 WP_001181004.1.97802 WP_001181004.1.97822 WP_001181004.1.97823 WP_001181004.1.97825 WP_001181004.1.97871 WP_001181004.1.97890 WP_001181004.1.97895 WP_001181004.1.97919 WP_001181004.1.97930 WP_001181004.1.97932 WP_001181004.1.97937 WP_001181004.1.97962 WP_001181004.1.97982 WP_001181004.1.97996 WP_001181004.1.98000 WP_001181004.1.98005 WP_001181004.1.98012 WP_001181004.1.98026 WP_001181004.1.9803 WP_001181004.1.98046 WP_001181004.1.98082 WP_001181004.1.98083 WP_001181004.1.981 WP_001181004.1.98102 WP_001181004.1.98115 WP_001181004.1.98139 WP_001181004.1.98155 WP_001181004.1.9816 WP_001181004.1.98167 WP_001181004.1.9817 WP_001181004.1.98176 WP_001181004.1.98187 WP_001181004.1.98202 WP_001181004.1.98205 WP_001181004.1.98208 WP_001181004.1.98220 WP_001181004.1.98232 WP_001181004.1.98235 WP_001181004.1.98239 WP_001181004.1.98241 WP_001181004.1.98244 WP_001181004.1.98251 WP_001181004.1.98279 WP_001181004.1.98284 WP_001181004.1.98292 WP_001181004.1.98294 WP_001181004.1.98301 WP_001181004.1.98312 WP_001181004.1.98323 WP_001181004.1.98355 WP_001181004.1.98357 WP_001181004.1.98384 WP_001181004.1.98400 WP_001181004.1.98404 WP_001181004.1.98424 WP_001181004.1.98429 WP_001181004.1.9844 WP_001181004.1.98442 WP_001181004.1.98451 WP_001181004.1.98466 WP_001181004.1.98477 WP_001181004.1.98480 WP_001181004.1.98484 WP_001181004.1.98498 WP_001181004.1.98543 WP_001181004.1.98549 WP_001181004.1.98569 WP_001181004.1.98578 WP_001181004.1.9858 WP_001181004.1.98587 WP_001181004.1.98603 WP_001181004.1.98614 WP_001181004.1.98626 WP_001181004.1.98628 WP_001181004.1.98633 WP_001181004.1.9864 WP_001181004.1.98641 WP_001181004.1.98654 WP_001181004.1.98665 WP_001181004.1.98668 WP_001181004.1.98683 WP_001181004.1.98702 WP_001181004.1.98727 WP_001181004.1.98757 WP_001181004.1.98775 WP_001181004.1.98776 WP_001181004.1.98784 WP_001181004.1.98795 WP_001181004.1.9883 WP_001181004.1.98849 WP_001181004.1.98875 WP_001181004.1.98886 WP_001181004.1.98908 WP_001181004.1.98920 WP_001181004.1.98976 WP_001181004.1.98988 WP_001181004.1.99006 WP_001181004.1.99029 WP_001181004.1.99046 WP_001181004.1.99053 WP_001181004.1.99060 WP_001181004.1.9907 WP_001181004.1.99101 WP_001181004.1.99110 WP_001181004.1.99119 WP_001181004.1.99168 WP_001181004.1.99182 WP_001181004.1.99209 WP_001181004.1.99234 WP_001181004.1.99246 WP_001181004.1.99265 WP_001181004.1.99289 WP_001181004.1.99292 WP_001181004.1.99295 WP_001181004.1.9930 WP_001181004.1.99302 WP_001181004.1.99304 WP_001181004.1.99306 WP_001181004.1.99307 WP_001181004.1.99310 WP_001181004.1.99319 WP_001181004.1.99334 WP_001181004.1.99345 WP_001181004.1.99349 WP_001181004.1.9935 WP_001181004.1.99361 WP_001181004.1.99366 WP_001181004.1.99392 WP_001181004.1.9940 WP_001181004.1.99400 WP_001181004.1.99401 WP_001181004.1.99427 WP_001181004.1.99446 WP_001181004.1.99453 WP_001181004.1.99458 WP_001181004.1.99471 WP_001181004.1.99472 WP_001181004.1.99475 WP_001181004.1.99486 WP_001181004.1.99487 WP_001181004.1.99498 WP_001181004.1.9950 WP_001181004.1.99501 WP_001181004.1.99511 WP_001181004.1.99534 WP_001181004.1.99549 WP_001181004.1.99562 WP_001181004.1.99571 WP_001181004.1.99592 WP_001181004.1.99602 WP_001181004.1.99603 WP_001181004.1.99619 WP_001181004.1.99632 WP_001181004.1.99641 WP_001181004.1.99666 WP_001181004.1.99692 WP_001181004.1.99694 WP_001181004.1.99698 WP_001181004.1.99734 WP_001181004.1.99771 WP_001181004.1.99774 WP_001181004.1.99782 WP_001181004.1.99791 WP_001181004.1.99804 WP_001181004.1.99827 WP_001181004.1.99869 WP_001181004.1.99874 WP_001181004.1.99891 WP_001181004.1.99892 WP_001181004.1.99912 WP_001181004.1.99929 WP_001181004.1.99986 YP_002409712.1.10275 YP_002414447.1.14968 YP_006121633.1.29421 YP_006777209.1.12065 YP_404966.1.10455 gi|238902412|ref|YP_002928208.1| gi|387613997|ref|YP_006117113.1| gi|387508713|ref|YP_006160969.1| gi|260870064|ref|YP_003236466.1| gi|110807168|ref|YP_690688.1| gi|82778617|ref|YP_404966.1| gi|82545684|ref|YP_409631.1| gi|407480060|ref|YP_006777209.1| gi|386605872|ref|YP_006112172.1| gi|378711239|ref|YP_005276132.1| gi|388479917|ref|YP_492111.1| gi|251786575|ref|YP_003000879.1| gi|383180495|ref|YP_005458500.1| gi|157162795|ref|YP_001460113.1| gi|209920787|ref|YP_002294871.1| gi|386631200|ref|YP_006150920.1| gi|253771855|ref|YP_003034686.1| gi|26249916|ref|NP_755956.1| gi|215488621|ref|YP_002331052.1| gi|157159214|ref|YP_001464789.1| gi|407471284|ref|YP_006782273.1| gi|30065378|ref|NP_839549.1| gi|218560382|ref|YP_002393295.1| gi|218702083|ref|YP_002409712.1| gi|222158025|ref|YP_002558164.1| gi|560159336|ref|YP_008852051.1| 000148748|e3j0uM1|304.44.1.1|M:1-103 000235880|e3j36J1|304.44.1.1|J:1-103 000415517|e3izvN1|304.44.1.1|N:1-103 000415539|e3izwN1|304.44.1.1|N:1-103 000417342|e3j00J1|304.44.1.1|J:1-103 000973982|e3j10M1|304.44.1.1|M:1-103 000973983|e3j13L1|304.44.1.1|L:1-103 000973985|e4gasJ1|304.44.1.1|J:1-103 000973986|e3j0vM1|304.44.1.1|M:1-103 000973987|e3j0xM1|304.44.1.1|M:1-103 000973989|e3j0zM1|304.44.1.1|M:1-103 001436215|e4v6kBN1|304.44.1.1|BN:1-103 001436238|e4v6lAN1|304.44.1.1|AN:1-103 001436297|e4v6mAJ1|304.44.1.1|AJ:1-103 001436391|e4v6nBM1|304.44.1.1|BM:1-103 001436411|e4v6oAM1|304.44.1.1|AM:1-103 001436469|e4v6pAM1|304.44.1.1|AM:1-103 001436527|e4v6qAM1|304.44.1.1|AM:1-103 001436584|e4v6rAM1|304.44.1.1|AM:1-103 001436678|e4v6sBL1|304.44.1.1|BL:1-103 001436830|e4v6vAJ1|304.44.1.1|AJ:1-103 001564355|e3j9zSJ1|304.44.1.1|SJ:1-103 001564423|e3ja1SJ1|304.44.1.1|SJ:1-103 cath|current|1vs5J00/5-102 cath|current|1vs7J00/5-102 cath|current|2avyJ00/5-102 cath|current|2aw7J00/5-102 cath|current|2i2pJ00/5-102 cath|current|2i2uJ00/5-102 cath|current|2qalJ00/5-102 cath|current|2qanJ00/5-102 cath|current|2qb9J00/5-102 cath|current|2qbbJ00/5-102 cath|current|2qbdJ00/5-102 cath|current|2qbfJ00/5-102 cath|current|2qbhJ00/5-102 cath|current|2qbjJ00/5-102 cath|current|2qouJ00/5-102 cath|current|2qowJ00/5-102 cath|current|2qoyJ00/5-102 cath|current|2qp0J00/5-102 cath|current|2vhoJ00/5-103 cath|current|2vhpJ00/5-103 cath|current|3df1J00/5-102 cath|current|3df3J00/5-102 gi|218555878|ref|YP_002388791.1| gi|254795258|ref|YP_003080095.1| gi|443619384|ref|YP_007383240.1| gi|386711214|ref|YP_006174935.1| gi|387622972|ref|YP_006130600.1| gi|387609027|ref|YP_006097883.1| gi|387618611|ref|YP_006121633.1| gi|254163249|ref|YP_003046357.1| gi|16131200|ref|NP_417780.1| gi|24114599|ref|NP_709109.1| gi|386620928|ref|YP_006140508.1| gi|544391789|ref|YP_008566475.1| gi|291284679|ref|YP_003501497.1| gi|218706928|ref|YP_002414447.1| gi|386636120|ref|YP_006155839.1| gi|209399386|ref|YP_002272777.1| gi|410480621|ref|YP_006768167.1| gi|91212758|ref|YP_542744.1| gi|386601338|ref|YP_006102844.1| gi|386616099|ref|YP_006135765.1| gi|386706565|ref|YP_006170412.1| gi|387884491|ref|YP_006314793.1| gi|15803848|ref|NP_289882.1| gi|218697013|ref|YP_002404680.1| 155864.Z4692 198214.SF3353 198215.S4409 199310.c4092 300267.SDY_3497 300268.SBO_3315 300269.SSON_3462 316385.ECDH10B_3496 316407.rpsJ 331111.EcE24377A_3804 331112.EcHS_A3515 344609.SbBS512_E3706 362663.ECP_3409 364106.UTI89_C3776 373384.SFV_3340 386585.ECs4186 405955.APECO1_3130 409438.ECSE_3596 413997.ECB_03172 439855.EcSMS35_3616 444450.ECH74115_4644 469008.ECBD_0430 481805.EcolC_0392 511145.b3321 544404.ECSP_4292 573235.ECO26_4423 574521.E2348C_3584 585034.ECIAI1_3470 585035.ECS88_3708 585055.EC55989_3737 585056.ECUMN_3794 585057.ECIAI39_3815 585395.ECO103_4053 585396.ECO111_4142 585397.ECED1_3984 595496.BWG_3012 gi|170082840|ref|YP_001732160.1| gi|471334867|ref|YP_007558344.1| gi|170018443|ref|YP_001723397.1| gi|387831199|ref|YP_003351136.1| gi|384544899|ref|YP_005728963.1| gi|260857442|ref|YP_003231333.1| gi|378711239|ref|YP_005276132.1| gi|386640916|ref|YP_006107714.1| gi|260846119|ref|YP_003223897.1| gi|387622972|ref|YP_006130600.1| gi|386626124|ref|YP_006145852.1| gi|170683626|ref|YP_001745583.1| gi|187733990|ref|YP_001882005.1| gi|74313840|ref|YP_312259.1| 3j9y_j 3j9z_SJ 3ja1_SJ 3jbu_J 3jbv_J 3jcd_j 3jce_j 3w1y_C 4adv_J 4v47_BJ 4v48_BJ 4v4h_AJ 4v4h_CJ 4v4q_AJ 4v4q_CJ 4v50_AJ 4v50_CJ 4v52_AJ 4v52_CJ 4v53_AJ 4v53_CJ 4v54_AJ 4v54_CJ 4v55_AJ 4v55_CJ 4v56_AJ 4v56_CJ 4v57_AJ 4v57_CJ 4v5b_BJ 4v5b_DJ 4v5y_AJ 4v5y_CJ 4v64_AJ 4v64_CJ 4v65_AX 4v66_AX 4v6c_AJ 4v6c_CJ 4v6d_AJ 4v6d_CJ 4v6e_AJ 4v6e_CJ 4v6k_BN 4v6l_AN 4v6m_AJ 4v6n_BM 4v6o_AM 4v6p_AM 4v6q_AM 4v6r_AM 4v6s_BL 4v6v_AJ 4v7b_AJ 4v7c_AJ 4v7d_BJ 4v7i_BJ 4v85_AJ 4v89_AJ 4v9c_AJ 4v9c_CJ 4v9o_BJ 4v9o_DJ 4v9o_FJ 4v9o_HJ 4v9p_BJ 4v9p_DJ 4v9p_FJ 4v9p_HJ 4woi_AJ 4woi_DJ 5afi_j 5h5u_q 5iqr_o 5jte_AJ 5ju8_AJ 5kcr_1j 5kcs_1j 5kps_15 5kpv_14 5kpw_14 5kpx_14 5l3p_j 5mdv_o 5mdw_o 5mdy_o 5mdz_o 5me0_J 5me1_J 5my1_J 5nwy_9 5u4i_j 5u9f_J 5u9g_J 5uz4_J 6c4i_j 6dnc_WA gi|544577861|ref|YP_008573385.1| gi|251786575|ref|YP_003000879.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]