SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2qv7A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2qv7A
Domain Number 1 Region: 25-314
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 4.32e-109
Family Diacylglycerol kinase-like 0.00000000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2qv7A   PDB: 2qv7
Sequence length 337
Comment (A:)
Sequence
mgsshhhhhhhssglvprgshmmrkrariiynptsgkeqfkrelpdaliklekagyetsa
yatekigdatleaeramhenydvliaaggdgtlnevvngiaekpnrpklgvipmgtvndf
gralhipndimgaldviieghstkvdigkmnnryfinlaaggqltqvsyetpsklksivg
pfayyikgfemlpqmkavdlrieydgnvfqgeallfflgltnsmagfeklvpdaklddgy
ftliiveksnlaelghimtlasrgehtkhpkviyekakainissftdlqlnvdgeyggkl
panflnlerhidvfapndivneelinndhvddnliee
Download sequence
Identical sequences 2qv7_A 2qvl_A 2qv7A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]