SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2tprA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2tprA
Domain Number 1 Region: 4-102,230-351
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.6e-52
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0000000771
Further Details:      
 
Domain Number 2 Region: 361-482
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 1.9e-32
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000345
Further Details:      
 
Domain Number 3 Region: 3-63,103-228
Classification Level Classification E-value
Superfamily Nucleotide-binding domain 7.91e-17
Family UDP-galactopyranose mutase, N-terminal domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2tprA   PDB: 2tpr
Sequence length 490
Comment (A:)
Sequence
sraydlvvigagsggleagwnaaslhkkrvavidlqkhhgpphyaalggtcvnvgcvpkk
lmvtganymdtiresagfgweldresvrpnwkaliaaknkavsgindsyegmfadteglt
fhqgfgalqdnhtvlvresadpnsavletldteyillatgswpqhlgiegddlcitsnea
fyldeapkralcvgggyisiefagifnaykarggqvdlayrgdmilrgfdselrkqlteq
lranginvrthenpakvtknadgtrhvvfesgaeadydvvmlaigrvprsqtlqlekagv
evakngaikvdaysktnvdniyaigdvtdrvmltpvainegaafvdtvfankpratdhtk
vacavfsippmgvcgyveedaakkydqvavyessftplmhnisgstykkfmvrivtnhad
gevlgvhmlgdsspeiiqsvaiclkmgakisdvyntigvhptsaeelcsmrtpayfyekg
krvekidsnl
Download sequence
Identical sequences 2tprA 2tpr_A 2tpr_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]