SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2v5zA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2v5zA
Domain Number 1 Region: 1-310,414-454
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.66e-77
Family FAD-linked reductases, N-terminal domain 0.0000000000402
Further Details:      
 
Domain Number 2 Region: 290-400
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.01e-35
Family L-aminoacid/polyamine oxidase 0.000000407
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2v5zA   PDB: 2v5z
Sequence length 520
Comment (A:)
Sequence
MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSY
VGPTQNRILRLAKELGLETYKVNEVERLIHHVKGKSYPFRGPFPPVWNPITYLDHNNFWR
TMDDMGREIPSDAPWKAPLAEEWDNMTMKELLDKLCWTESAKQLATLFVNLCVTAETHEV
SALWFLWYVKQCGGTTRIISTTNGGQERKFVGGSGQVSERIMDLLGDRVKLERPVIYIDQ
TRENVLVETLNHEMYEAKYVISAIPPTLGMKIHFNPPLPMMRNQMITRVPLGSVIKCIVY
YKEPFWRKKDYCGTMIIDGEEAPVAYTLDDTKPEGNYAAIMGFILAHKARKLARLTKEER
LKKLCELYAKVLGSLEALEPVHYEEKNWCEEQYSGGCYTTYFPPGILTQYGRVLRQPVDR
IYFAGTETATHWSGYMEGAVEAGERAAREILHAMGKIPEDEIWQSEPESVDVPAQPITTT
FLERHLPSVPGLLRLIGLTTIFSATALGFLAHKRGLLVRV
Download sequence
Identical sequences P27338
9606.ENSP00000367309 1gos_A 1gos_B 1oj9_A 1oj9_B 1oja_A 1oja_B 1ojc_A 1ojc_B 1ojd_A 1ojd_B 1ojd_C 1ojd_D 1ojd_E 1ojd_F 1ojd_G 1ojd_H 1ojd_I 1ojd_L 1s2q_A 1s2q_B 1s2y_A 1s2y_B 1s3b_A 1s3b_B 1s3e_A 1s3e_B 2bk3_A 2bk3_B 2byb_A 2byb_B 2c64_A 2c64_B 2c65_A 2c65_B 2c66_A 2c66_B 2c67_A 2c67_B 2c70_A 2c70_B 2v5z_A 2v5z_B 2v60_A 2v60_B 2v61_A 2v61_B 2vrl_A 2vrl_B 2vrm_A 2vrm_B 2vz2_A 2vz2_B 2xcg_A 2xcg_B 2xfn_A 2xfn_B 2xfp_A 2xfp_B 2xfq_A 2xfq_B 3po7_A 3po7_B 4a79_A 4a79_B 4a7a_A 4a7a_B 4crt_A 4crt_B 5mrl_A 5mrl_B 6fvz_A 6fvz_B 6fw0_A 6fw0_B 6fwc_A 6fwc_B ENSP00000367309 ENSP00000367309 gi|38202207|ref|NP_000889.3| NP_000889.3.87134 NP_000889.3.92137 2v5zA ENSP00000367309

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]