SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2vouA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2vouA
Domain Number 1 Region: 3-161,293-370
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.91e-44
Family FAD-linked reductases, N-terminal domain 0.00000000376
Further Details:      
 
Domain Number 2 Region: 164-290
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 3.84e-37
Family PHBH-like 0.000000125
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2vouA   PDB: 2vou
Sequence length 397
Comment (A:)
Sequence
mspttdriavvggsisgltaalmlrdagvdvdvyerspqplsgfgtgivvqpelvhylle
qgveldsisvpsssmeyvdaltgervgsvpadwrftsydsiygglyelfgperyhtskcl
vglsqdsetvqmrfsdgtkaeanwvigadggasvvrkrllgieptyagyvtwrgvlqpge
vaddvwnyfndkftygllddghliaypipgrenaesprlnfqwywnvaegpdldelmtdv
rgirlptsvhnnslnphnlrqfhskgeslfkpfrdlvlnasspfvtvvadatvdrmvhgr
vlligdaavtprphaaaggakasddartlaevftknhdlrgslqswetrqlqqghaylnk
vkkmasrlqhggsfepgnpafafglpkvdepsvvtns
Download sequence
Identical sequences 2vou_A 2vou_B 2vou_C 2vouA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]