SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2z0sA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2z0sA
Domain Number 1 Region: 61-145
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.68e-19
Family Cold shock DNA-binding domain-like 0.0000127
Further Details:      
 
Domain Number 2 Region: 150-228
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.00000000000000437
Family Eukaryotic type KH-domain (KH-domain type I) 0.0000184
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2z0sA   PDB: 2z0s
Sequence length 235
Comment (A:)
Sequence
MSSERQLAGRIVVPGEPLPEEVEASPPYVIDYKGVKRATVVGLLREKGDGGGRAFVKLKE
IYVPQAGDVVIGLIQSVGIMNWFVDINSPYVAVLSVQDFLGRPFNPAVDDMQSLLKVGDY
IKAKVVAFDKTRSPLLTVQGEGLGRIVRGKIVEISPAKVPRVIGRKMSMLKTLEEKTECK
IFVARNGRIHLECPNEDLEAIAVMAIKIIDEEAYTSGLTKRIIKFIEEERRIREV
Download sequence
Identical sequences Q9YC02
2z0sA 272557.APE_1448 ape001001448.1 ape001001448.2 2z0s_A gi|14601413|ref|NP_147950.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]