SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 2zncA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  2zncA
Domain Number 1 Region: 13-256
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.03e-107
Family Carbonic anhydrase 0.0000000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 2zncA   PDB: 2znc   SUPERFAMILY: 2zncA
Sequence length 258
Comment (A:)
Sequence
wcyeiqtedprssclgpekwpgackenqqspinivtartkvnprltpfilvgydqkqqwp
iknnqhtvemtlgggaciiggdlparyeavqlhlhwsngndngsehsidgrhfamemhiv
hkkltsskedskdkfavlafmievgdkvnkgfqplvealpsiskphststvresslqdml
ppstkmytyfryngslttpncdetviwtvykqpikihknqflefsknlyydedqklnmkd
nvrplqplgkrqvfksha
Download sequence
Identical sequences 2zncA 2znc_A 3znc_A cath|current|2zncA00/5-261 cath|current|3zncA00/5-261 d2znca_ d3znca_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]