SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3b3rA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3b3rA
Domain Number 1 Region: 316-447
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.2e-55
Family GMC oxidoreductases 0.000000119
Further Details:      
 
Domain Number 2 Region: 10-312,444-502
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.59e-41
Family FAD-linked reductases, N-terminal domain 0.0000000000062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3b3rA   PDB: 3b3r
Sequence length 506
Comment (A:)
Sequence
sadnggyvpavvigtgygaavsalrlgeagvqtlmlemgqlwnqpgpdgnifcgmlnpdk
rsswfknrteaplgsflwldvvnrnidpyagvldrvnydqmsvyvgrgvgggslvnggma
vepkrsyfeeilprvdssemydryfpransmlrvnhidtkwfedtewykfarvsreqagk
aglgtvfvpnvydfgymqreaagevpksalateviygnnhgkqsldktylaaalgtgkvt
iqtlhqvktirqtkdggyaltveqkdtdgkllatkeiscrylflgagslgstellvrard
tgtlpnlnsevgagwgpngnimtaranhmwnptgahqssipalgidawdnsdssvfaqia
pmpagletwvslylaitknpqrgtfvydaatdraklnwtrdqnapavnaakalfdrinka
ngtiyrydlfgtqlkafaddfcyqplggcvlgkatddygrvagyknlyvtdgslipgsvg
vnpfvtitalaernveriikqdvtas
Download sequence
Identical sequences 3b3r_A 3b3rA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]