SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3bbnJ from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3bbnJ
Domain Number 1 Region: 100-197
Classification Level Classification E-value
Superfamily Ribosomal protein S10 8.78e-34
Family Ribosomal protein S10 0.0000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3bbnJ   PDB: 3bbn
Sequence length 197
Comment (J:)
Sequence
MATSSLSTIVFSPLALSNSSSFPNKPQVSNLSLHSSLSNLRRTLSHSSPSSSSSSNVRVF
AAPEVLESQETGPESYVEEGSETSALGIGADSDQMAPKQKIRIKLRSYWVPLIEDSCKQI
MDAARTTNAKTMGPVPLPTKKRIFCVLKSPHVHKDARFHFEIRTHQRLIDILYPTAQTID
SLMQLDLPAGVDVEVKL
Download sequence
Identical sequences Q9M4Y3
4v61_AJ 3bbnJ

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]