SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3bhkA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3bhkA
Domain Number 1 Region: 4-219,322-379
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.73e-50
Family FAD-linked reductases, N-terminal domain 0.000000000455
Further Details:      
 
Domain Number 2 Region: 219-321
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.17e-29
Family D-aminoacid oxidase-like 0.000000665
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3bhkA   PDB: 3bhk
Sequence length 390
Comment (A:)
Sequence
msthfdvivvgagsmgmaagyqlakqgvktllvdafdpphtngshhgdtkiirhaygegr
eyvplalrsqelwyelekethhkiftktgvlvfgpkgesafvaetmeaakehsltvdlle
gdeinkrwpgitvpenynaifepnsgvlfsencirayrelaeargakvlthtrvedfdis
pdsvkietangsytadklivsmgawnskllsklnldiplqpyrqvvgffesdeskysndi
dfpgfmvevpngiyygfpsfggcglklgyhtfgqkidpdtinrefgvypedesnlrafle
eympgangelkrgavcmytktldehfiidlhpehsnvviaagfsghgfkfssgvgevlsq
laltgktehdisifsinrpalkeslqktti
Download sequence
Identical sequences 3bhkA 3bhf_A 3bhf_B 3bhk_A 3bhk_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]