SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3bl2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3bl2A
Domain Number 1 Region: 2-131
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 4.13e-88
Family Bcl-2 inhibitors of programmed cell death 0.000000317
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3bl2A   PDB: 3bl2
Sequence length 131
Comment (A:)
Sequence
ksgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyradygpal
knwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcmthffi
ennlmnhfple
Download sequence
Identical sequences 3bl2_A 3bl2_B 3bl2A cath|current|3bl2A00/5-135 cath|current|3bl2B00/5-135 d3bl2a_ d3bl2b_ d3dvub_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]