SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3c96A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3c96A
Domain Number 1 Region: 5-178,289-366
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.51e-66
Family FAD-linked reductases, N-terminal domain 0.00000000187
Further Details:      
 
Domain Number 2 Region: 185-293
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.42e-31
Family PHBH-like 0.000000451
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3c96A   PDB: 3c96
Sequence length 410
Comment (A:)
Sequence
msepidiliagagigglscalalhqagigkvtllessseirplgvginiqpaavealael
glgpalaataipthelryidqsgatvwseprgveagnaypqysihrgelqmillaavrer
lgqqavrtglgverieerdgrvligardghgkpqalgadvlvgadgihsavrahlhpdqr
plshggitmwrgvtefdrfldgktmivandehwsrlvaypisarhaaegkslvnwvcmvp
saavgqldneadwnrdgrledvlpffadwdlgwfdirdlltrnqlilqypmvdrdplphw
grgritllgdaahlmypmgangasqaildgielaaalarnadvaaalreyeearrptank
iilanrerekeewaaasrpkteksaaleaitgsyrnqverprlehhhhhh
Download sequence
Identical sequences 3c96A 3c96_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]