SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3coxA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3coxA
Domain Number 1 Region: 319-450
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 6.48e-62
Family GMC oxidoreductases 0.0000001
Further Details:      
 
Domain Number 2 Region: 8-318,446-502
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.25e-37
Family FAD-linked reductases, N-terminal domain 0.0000000000168
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3coxA   PDB: 3cox
Sequence length 507
Comment (A:)
Sequence
apsrtladgdrvpalvigsgyggavaalrltqagiptqivemgrswdtpgsdgkifcgml
npdkrsmwladktdqpvsnfmgfginksidryvgvldserfsgikvyqgrgvgggslvng
gmavtpkrnyfeeilpsvdsnemynkyfprantglgvnnidqawfestewykfartgrkt
aqrsgfttafvpnvydfeymkkeaagqvtksglggeviygnnagkksldktylaqaaatg
kltittlhrvtkvapatgsgysvtmeqideqgnvvatkvvtadrvffaagsvgtskllvs
mkaqghlpnlssqvgegwgnngnimvgranhmwdatgskqatiptmgidnwadptapifa
eiaplpagletyvslylaitknperarfqfnsgtgkvdltwaqsqnqkgidmakkvfdki
nqkegtiyrtdlfgvyyktwgddftyhplggvllnkatdnfgrlpeypglyvvdgslvpg
nvgvnpfvtitalaernmdkiissdiq
Download sequence
Identical sequences 1coy_A 3cox_A 3coxA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]