SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3cpiG from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3cpiG
Domain Number 1 Region: 7-298
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.68e-68
Family GDI-like N domain 0.00000000004
Further Details:      
 
Domain Number 2 Region: 305-399
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.27e-41
Family GDI-like 0.00000197
Further Details:      
 
Domain Number 3 Region: 400-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.0000000000000481
Family GDI-like N domain 0.0000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3cpiG   PDB: 3cpi
Sequence length 451
Comment (G:)
Sequence
MDQETIDTDYDVIVLGTGITECILSGLLSVDGKKVLHIDKQDHYGGEAASVTLSQLYEKF
KQNPISKEERESKFGKDRDWNVDLIPKFLMANGELTNILIHTDVTRYVDFKQVSGSYVFK
QGKIYKVPANEIEAISSPLMGIFEKRRMKKFLEWISSYKEDDLSTHQGLDLDKNTMDEVY
YKFGLGNSTKEFIGHAMALWTNDDYLQQPARPSFERILLYCQSVARYGKSPYLYPMYGLG
ELPQGFARLSAIYGGTYMLDTPIDEVLYKKDTGKFEGVKTKLGTFKAPLVIADPTYFPEK
CKSTGQRVIRAICILNHPVPNTSNADSLQIIIPQSQLGRKSDIYVAIVSDAHNVCSKGHY
LAIISTIIETDKPHIELEPAFKLLGPIEEKFMGIAELFEPREDGSKDNIYLSRSYDASSH
FESMTDDVKDIYFRVTGHPLVLKQRQEQEKQ
Download sequence
Identical sequences A0A0L8VRI3 A6ZR94 B3LRQ0 B5VHR3 C7GT28 C8Z7F6 E7KBX4 E7LTT6 E7QE24 N1P5C3 P39958
NP_011062.1.97178 YER136W YER136W 3cph_G 3cph_H 3cpi_G 3cpi_H 3cpj_G YER136W YER136W YER136W 3cpiG tr|A6ZR94|A6ZR94_YEAS7 YER136W 4932.YER136W YER136W YER136W YER136W YER136W YER136W YER136W SCRT_04612 YER136w___KOG1439 YER136W YER136W YER136W YER136W

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]