SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3dssB from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3dssB
Domain Number 1 Region: 11-322
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 1.24e-111
Family Protein prenyltransferases 0.0000000000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3dssB   PDB: 3dss
Sequence length 331
Comment (B:)
Sequence
MGTQQKDVTIKSDAPDTLLLEKHADYIASYGSKKDDYEYCMSEYLRMSGVYWGLTVMDLM
GQLHRMNKEEILVFIKSCQHECGGVSASIGHDPHLLYTLSAVQILTLYDSIHVINVDKVV
AYVQSLQKEDGSFAGDIWGEIDTRFSFCAVATLALLGKLDAINVEKAIEFVLSCMNFDGG
FGCRPGSESHAGQIYCCTGFLAITSQLHQVNSDLLGWWLCERQLPSGGLNGRPEKLPDVC
YSWWVLASLKIIGRLHWIDREKLRSFILACQDEETGGFADRPGDMVDPFHTLFGIAGLSL
LGEEQIKPVSPVFCMPEEVLQRVNVQPELVS
Download sequence
Identical sequences Q08603
3dssB NP_619715.1.100692 NP_619715.1.4139 cath|current|1dceB00/3-331 cath|current|1dceD00/3-331 cath|current|1ltxB00/6-331 cath|current|3c72B00/7-331 cath|current|3dssB00/5-331 cath|current|3dstB00/5-331 cath|current|3dsuB00/5-331 cath|current|3dsvB00/5-331 cath|current|3dswB00/5-330 cath|current|3dsxB00/5-331 cath|current|3hxbB00/5-331 cath|current|3hxcB00/5-331 cath|current|3hxdB00/5-331 cath|current|3hxeB00/5-331 cath|current|3hxfB00/5-330 1dce_B 1dce_D 1ltx_B 3c72_B 3dss_B 3dst_B 3dsu_B 3dsv_B 3dsw_B 3dsx_B 3hxb_B 3hxc_B 3hxd_B 3hxe_B 3hxf_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]