SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3dvuA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3dvuA
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 1.38e-88
Family Bcl-2 inhibitors of programmed cell death 0.000000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3dvuA   PDB: 3dvu
Sequence length 143
Comment (A:)
Sequence
mashkksgtywatlitaflktvskveeldcvdsavlvdvskiitltqefrrhydsvyrad
ygpalknwkrdlsklftslfvdvinsgrivgffdvgryvceevlcpgswtedhellndcm
thffiennlmnhfpledhhhhhh
Download sequence
Identical sequences 3dvu_A 3dvu_B 4mi8_A 4mi8_B 3dvuA cath|current|3dvuA00/5-134 cath|current|3dvuB00/5-135 cath|current|4mi8A00/2-136 cath|current|4mi8B00/2-137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]