SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3grtA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3grtA
Domain Number 1 Region: 349-461
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 5.78e-65
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000613
Further Details:      
 
Domain Number 2 Region: 4-60,87-340
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.36e-49
Family FAD/NAD-linked reductases, N-terminal and central domains 0.000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3grtA   PDB: 3grt
Sequence length 461
Comment (A:)
Sequence
vasydylvigggsgglesawraaelgaraavveshklggtcvnvgcvpkkvmwntavhse
fmhdhadygfpscegkfnwrvikekrdayvsrlnaiyqnnltkshieiirghaaftsdpk
ptievsgkkytaphiliatggmpstphesqipgaslgitsdgffqleelpgrsvivgagy
iavemagilsalgsktslmirhdkvlrsfdsmistncteelenagvevlkfsqvkevkkt
lsglevsmvtavpgrlpvmtmipdvdcllwaigrvpntkdlslnklgiqtddkghiivde
fqntnvkgiyavgdvcgkalltpvaiaagrklahrlfeykedskldynniptvvfshppi
gtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvcankeekvvgihmqg
lgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr
Download sequence
Identical sequences 2grt_A 3grt_A 4grt_A 5grt_A 3grtA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]