SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 3ladA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  3ladA
Domain Number 1 Region: 352-461
Classification Level Classification E-value
Superfamily FAD/NAD-linked reductases, dimerisation (C-terminal) domain 3.51e-63
Family FAD/NAD-linked reductases, dimerisation (C-terminal) domain 0.000000898
Further Details:      
 
Domain Number 2 Region: 2-345
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.18e-60
Family FAD/NAD-linked reductases, N-terminal and central domains 0.00000049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 3ladA   PDB: 3lad
Sequence length 476
Comment (A:)
Sequence
sqkfdvivigagpggyvaaiksaqlglktaliekykgkegktalggtclnvgcipskall
dssykfheahesfklhgistgevaidvptmiarkdqivrnltggvaslikangvtlfegh
gkllagkkvevtaadgssqvldtenvilasgskpveippapvdqdvivdstgaldfqnvp
gklgvigagviglelgsvwarlgaevtvleamdkflpavdeqvakeaqkiltkqglkill
garvtgtevknkqvtvkfvdaegeksqafdklivavgrrpvttdllaadsgvtldergfi
yvddycatsvpgvyaigdvvrgamlahkaseegvvvaeriaghkaqmnydlipaviythp
eiagvgkteqalkaegvainvgvfpfaasgramaandtagfvkviadaktdrvlgvhvig
psaaelvqqgaiamefgtsaedlgmmvfahpalsealheaalavsghaihvanrkk
Download sequence
Identical sequences 3lad_A 3lad_B 3ladA

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]