SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 7ca2A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  7ca2A
Domain Number 1 Region: 5-259
Classification Level Classification E-value
Superfamily Carbonic anhydrase 9.2e-143
Family Carbonic anhydrase 0.0000000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 7ca2A   PDB: 7ca2   SUPERFAMILY: 7ca2A
Sequence length 260
Comment (A:)
Sequence
mshhwgygkhngpehwhkdfpiakgerqspvdidthtakydpslkplsvsydqatslril
nnghafnvefddsqdkavlkggpldgtyrliqfhfhwgsldgqgsehtvdkkkyaaelhl
vhwntkygdfgkavqqpdglaglgiflkvgsakpglqkvvdvldsiktkgksadftnfdp
rgllpesldywtypgslttppllecvtwivlkepisvsseqvlkfrklnfngegepeelm
vdnwrpaqplknrqikasfk
Download sequence
Identical sequences 7ca2A 7ca2_A cath|current|7ca2A00/5-260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]