SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 8abpA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  8abpA
Domain Number 1 Region: 3-302
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.81e-71
Family L-arabinose binding protein-like 0.0000000144
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 8abpA   PDB: 8abp   SUPERFAMILY: 8abpA
Sequence length 306
Comment (A:)
Sequence
enlklgflvkqpeepwfqtewkfadkagkdlgfevikiavpdgektlnaidslaasgakg
fvictpdpklgsaivakargydmkviavddqfvnakgkpmdtvplvmlaatkigerqgqe
lykemqkrgwdvkesavmaitaneldtarrrttgsmdalkaagfpekqiyqvptksndip
gafdaansmlvqhpevkhwlivgmndstvlggvrategqgfkaadiigigingvdavsel
skaqatgfygsllpspdvhgykssemlynwvakdveppkftevtdvvlitrdnfkeelek
kglggk
Download sequence
Identical sequences 8abpA 6abp_A 7abp_A 8abp_A

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]