SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1g8fA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1g8fA
Domain Number 1 Region: 172-387
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.85e-131
Family ATP sulfurylase catalytic domain 0.000000021
Further Details:      
 
Domain Number 2 Region: 3-168
Classification Level Classification E-value
Superfamily PUA domain-like 7.03e-78
Family ATP sulfurylase N-terminal domain 0.000000198
Further Details:      
 
Domain Number 3 Region: 390-510
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.85e-35
Family ATP sulfurylase C-terminal domain 0.000000601
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1g8fA   PDB: 1g8f
Sequence length 511
Comment (A:)
Sequence
mpaphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfspltgfl
nendyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtvqdv
ykpnktieaervfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpaqlr
lefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhhtrvr
vyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgknsk
gvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnisgte
lrrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsiallstfl
qfgggryykifehnnktellsliqdfigsgsgliipdqweddkdsvvgkqnvylldtsss
adiqlesadepishivqkvvlfledngffvf
Download sequence
Identical sequences 1g8fA 1g8f_A 1g8g_A 1g8g_B 1g8h_A 1g8h_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]