SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1i2dA from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1i2dA
Domain Number 1 Region: 174-388
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.16e-136
Family ATP sulfurylase catalytic domain 0.0000000131
Further Details:      
 
Domain Number 2 Region: 4-170
Classification Level Classification E-value
Superfamily PUA domain-like 9.54e-86
Family ATP sulfurylase N-terminal domain 0.000000225
Further Details:      
 
Domain Number 3 Region: 396-561
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.52e-67
Family ATP sulfurylase C-terminal domain 0.00000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1i2dA   PDB: 1i2d
Sequence length 573
Comment (A:)
Sequence
MANAPHGGVLKDLLARDAPRQAELAAEAESLPAVTLTERQLCDLELIMNGGFSPLEGFMN
QADYDRVCEDNRLADGNVFSMPITLDASQEVIDEKKLQAGSRITLRDFRDDRNLAILTID
DIYRPDKTKEAKLVFGGDPEHPAIVYLNNTVKEFYIGGKIEAVNKLNHYDYVALRYTPAE
LRVHFDKLGWSRVVAFQTRNPMHRAHRELTVRAARSRQANVLIHPVVGLTKPGDIDHFTR
VRAYQALLPRYPNGMAVLGLLGLAMRMGGPREAIWHAIIRKNHGATHFIVGRDHAGPGSN
SKGEDFYGPYDAQHAVEKYKDELGIEVVEFQMVTYLPDTDEYRPVDQVPAGVKTLNISGT
ELRRRLRSGAHIPEWFSYPEVVKILRESNPPRATQGFTIFLTGYMNSGKDAIARALQVTL
NQQGGRSVSLLLGDTVRHELSSELGFTREDRHTNIQRIAFVATELTRAGAAVIAAPIAPY
EESRKFARDAVSQAGSFFLVHVATPLEHCEQSDKRGIYAAARRGEIKGFTGVDDPYETPE
KADLVVDFSKQSVRSIVHEIILVLESQGFLERQ
Download sequence
Identical sequences A0A167S984 B6HEK3
1i2d_A 1i2d_B 1i2d_C jgi|Pench1|66433|e_gw1.1.413.1 1i2dA 500485.B6HEK3 Pchr_Wisconsin_54-1255:Pc20g07710.t1 XP_002563294.1.37043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]