SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 1j70A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1j70A
Domain Number 1 Region: 175-390
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 5.85e-131
Family ATP sulfurylase catalytic domain 0.000000021
Further Details:      
 
Domain Number 2 Region: 6-171
Classification Level Classification E-value
Superfamily PUA domain-like 9.54e-78
Family ATP sulfurylase N-terminal domain 0.000000198
Further Details:      
 
Domain Number 3 Region: 393-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.02e-35
Family ATP sulfurylase C-terminal domain 0.000000642
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1j70A   PDB: 1j70
Sequence length 514
Comment (A:)
Sequence
gshmpaphggilqdliardalkknellseaqssdilvwnltprqlcdielilnggfsplt
gflnendyssvvtdsrladgtlwtipitldvdeafanqikpdtrialfqddeipiailtv
qdvykpnktieaekvfrgdpehpaisylfnvagdyyvggsleaiqlpqhydypglrktpa
qlrlefqsrqwdrvvafqtrnpmhrahreltvraareanakvlihpvvgltkpgdidhht
rvrvyqeiikrypngiaflsllplamrmsgdreavwhaiirknygashfivgrdhagpgk
nskgvdfygpydaqelvesykheldievvpfrmvtylpdedryapidqidttktrtlnis
gtelrrrlrvggeipewfsypevvkilresnpprpkqgfsivlgnsltvsreqlsialls
tflqfgggryykifehnnktellsliqdfigsgsgliipnqweddkdsvvgkqnvylldt
sssadiqlesadepishivqkvvlfledngffvf
Download sequence
Identical sequences 1j70A 1j70_A 1j70_B 1j70_C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]