SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 1zy3A from PDB chains (SCOP 1.75)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  1zy3A
Domain Number 1 Region: 8-146
Classification Level Classification E-value
Superfamily Bcl-2 inhibitors of programmed cell death 3.07e-58
Family Bcl-2 inhibitors of programmed cell death 0.000000606
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SCOP: 1zy3A   PDB: 1zy3
Sequence length 178
Comment (A:)
Sequence
atpasapdtralvadfvgyklrqkgyvcgagpgegpaadplhqamraagdefetrfrrtf
sdlaaqlhvtpgsaqqrftqvsdelfqggpnwgrlvaffvfgaalcaesvnkemevlvgq
vqewmvayletrladwihssggwaeftalygdgaleearrlregnwasvrlehhhhhh
Download sequence
Identical sequences 1mk3_A 1zy3_A 1zy3A cath|current|1mk3A00/1-178

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]