SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297622497|ref|YP_003703931.1| from Truepera radiovictrix DSM 17093

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297622497|ref|YP_003703931.1|
Domain Number 1 Region: 147-340,474-584
Classification Level Classification E-value
Superfamily Subtilisin-like 1.09e-74
Family Subtilases 0.0000347
Further Details:      
 
Domain Number 2 Region: 360-451
Classification Level Classification E-value
Superfamily PA domain 0.00000000000000314
Family PA domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297622497|ref|YP_003703931.1|
Sequence length 847
Comment peptidase S8 and S53 subtilisin kexin sedolisin [Truepera radiovictrix DSM 17093]
Sequence
MRKTLVTLVVGVCVALSACANVQRDTLESVEPQASEVRPTNPLPKPPSGIIDETPRYWFV
QFAGPPTARGGNAATLRQQRAAFRSAAAGEGISYSERYNFERLFNGLSVRATASELGKLS
RLPNVTAVYPVIDVPRPEPRAVSEPDMQFALAMTGADTAQNELGLTGRGVKVGVIDSGVA
VNHPEFRGRIVAGYDFVGDAFNGSNTPQPDPNPDDCGGHGTHVAGIIGAAGERVRGVAPE
VSLGAYRVFGCEGSTTADIIILALERALADGMDVVNMSLGAAYQWPQYPSAQAADNLVDA
GVVVVASIGNSGATGVYSAGAPGVGHKVIGVASYDNAAVELNLMTVAGRSIGYSPMSGAA
APPTSGSAEIVWVGRACNGDALASDPSGKVALIVRGDCTFAEKALNAQNAGAIAAVVHNN
VAGNFAGSVSGNVTIPVVSISQADGLFIRERAPTTLTWENARGVFPNPTGGLISSFSSYG
LAPDLTLKPDLGAPGGSITSTYPLHLGGYATLSGTSMSAPHVAGAVALLLQARPNTRAAD
VRGLLQNTAQPKPWGLNPNIGFLDAVHRQGAGMINIPAAIQGATTVSPSKLSLGESQGGA
FSTTLTVRNTSSATMSYTLRNRGNTIATGGNTYTPSFFASSPNVTFSQNTLTVPAGGSAT
VNVTITPNPALPDLSVYGGYLELVTADGAVAASVPYSGFKGDYQAIRVLEPTRFGFPWLA
KRQDGAYVHQPSNTTFTMQGDDIAYVVAHFEHQSRVVKLEVVPLRQVGGARDLTVFESEF
FGRNSTPEGIFAFSWDGSAKVNGRRTPLPMGDYQLKLTVQKALGDPNNPNHFETWTSPVI
TISRSGR
Download sequence
Identical sequences D7CY28
WP_013176768.1.68051 gi|297622497|ref|YP_003703931.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]