SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297623682|ref|YP_003705116.1| from Truepera radiovictrix DSM 17093

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297623682|ref|YP_003705116.1|
Domain Number 1 Region: 1-122
Classification Level Classification E-value
Superfamily AF1862-like 6.02e-31
Family Cas Cmr5-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|297623682|ref|YP_003705116.1|
Sequence length 128
Comment Cmr5 family CRISPR-associated protein [Truepera radiovictrix DSM 17093]
Sequence
MSQTLAQRRAADALRNVEELKYRGDYGNYKSYVKALPANILMSGLGQAIATVRSRDRKGY
PQLYKHLEGWLCGPDEDAPYRNYTPGLLKAIVAHDQDHYIRAQAEAMAYLEWLRKFADAF
LEGGEERE
Download sequence
Identical sequences D7CXH1
WP_013177941.1.68051 gi|297623682|ref|YP_003705116.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]