SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297624330|ref|YP_003705764.1| from Truepera radiovictrix DSM 17093

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297624330|ref|YP_003705764.1|
Domain Number 1 Region: 6-310
Classification Level Classification E-value
Superfamily DmpA/ArgJ-like 1.1e-62
Family DmpA-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|297624330|ref|YP_003705764.1|
Sequence length 313
Comment peptidase S58 DmpA [Truepera radiovictrix DSM 17093]
Sequence
MARESAPVGTLCDVAGLRVGHWSDPEAQTGCTVVVCPDEGCVASGEVRGGAPGTRETALL
APEKSVQRVHAVVLSGGSAFGLAAATGVVEALEARGVGFPTPFGVVPIVPAAVIYDLGVG
RPLPRPDAEAGRSALEAASAAPIAQGRVGAGTGASCGKYLGFERAEPSGLGSAARTVQGA
VVAALSVANPVGDLVDPSTGAVVAGARLADGRRPPPERRLETFTDALAGTNTTLVVVATD
APLSKTEAYVLAQSAHVGIARVTRPSHTPSDGDTTFALSTGRGPKVPLTLLAVAAQEVVA
EAIVRGAAAARVS
Download sequence
Identical sequences D7CRD3
WP_013178585.1.68051 gi|297624330|ref|YP_003705764.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]