SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|297624702|ref|YP_003706136.1| from Truepera radiovictrix DSM 17093

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297624702|ref|YP_003706136.1|
Domain Number 1 Region: 341-566
Classification Level Classification E-value
Superfamily PHP domain-like 3.79e-48
Family PHP domain 0.0019
Further Details:      
 
Domain Number 2 Region: 172-322
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.0000000000000157
Family DNA polymerase beta-like 0.0086
Further Details:      
 
Domain Number 3 Region: 11-84
Classification Level Classification E-value
Superfamily DNA polymerase beta, N-terminal domain-like 0.0000000131
Family DNA polymerase beta, N-terminal domain-like 0.0079
Further Details:      
 
Domain Number 4 Region: 71-147
Classification Level Classification E-value
Superfamily Sec63 N-terminal domain-like 0.0000222
Family Achaeal helicase C-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297624702|ref|YP_003706136.1|
Sequence length 583
Comment PHP domain-containing protein [Truepera radiovictrix DSM 17093]
Sequence
MTEPPSPPAATLWPDKKSLVRQLLEVSRLLEVLGAEPYRAAAYAGAARRLEAYEGDLTPL
LEAGRLTEVRGVGPGVAAAVEALRGRGAPQLPLLEALYAEVPEGVLGLLRVAGLGPKKVR
ALWQAGIADLDALLAAAGDGRLAKVRGFGAKSAAAVTAAARFALEARERERLDEAEVRAA
RFEALCKTLAPEATLERAGELRRALETVGALSFVVTGLPVTVLAERLASLGATPSEGGEL
HLSFEGRPLELWCADAEALGAALACRTGSEAFVAALAAHAAAKGLRLTPAGLLRGETLLP
TPTEAALWTQLGLPMVPPERREGGLVGDEALVTLTDIRGLVHNHTTWSDGACSLDEMVAA
ARALGYRYLALADHSRTSYYANGLSVERVFEQARAVARLREALDRDGADFKVLHGLEVDI
LPDGSLDYPDEVLAKLDYTVISVHQHFTLDKVKQTERLVRAVQHPYASILGHLTGRLLLR
RPPYEVDVMAVLAACAEAGTVVEINANPRRLDLDWRLVARAKALGCRFAIDPDAHHVDGY
HDLRYGVLMARKAGLSAIDVVNTAPDAGAFLARLKPSRAPVGG
Download sequence
Identical sequences D7CTP6
WP_013178954.1.68051 gi|297624702|ref|YP_003706136.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]