SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|297625034|ref|YP_003706468.1| from Truepera radiovictrix DSM 17093

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|297625034|ref|YP_003706468.1|
Domain Number 1 Region: 11-249
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.85e-75
Family Sir2 family of transcriptional regulators 0.00000241
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|297625034|ref|YP_003706468.1|
Sequence length 254
Comment silent information regulator protein Sir2 [Truepera radiovictrix DSM 17093]
Sequence
MSVPVGGGAEAALGAVRARLARARRVAALTGAGVSAASGLPTFRGALGFWREHRAEDLAT
PQAYARDPLLVWEWYAARFHAAAAAAPNGAHLHLARLEAQLPDFTLVTQNVDGLHARSGS
RRVLELHGNLTKSRCERCGHLDALAPGFALPPCCSRCGSRARPNVVWFGEHLPERAFEAA
AAAFSRAEVALVIGTSGVVEPAASLGRLAAQRGAVVVEINPEPTPLTPYATLSLRQDAVS
GLHALLGPLTPPPG
Download sequence
Identical sequences D7CVL4
gi|297625034|ref|YP_003706468.1| WP_013179284.1.68051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]