SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0070467 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0070467
Domain Number 1 Region: 53-181
Classification Level Classification E-value
Superfamily Plus3-like 1.44e-37
Family Plus3 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0070467   Gene: FBgn0040356   Transcript: FBtr0070489
Sequence length 261
Comment pep:known chromosome:BDGP5:X:2703914:2704879:1 gene:FBgn0040356 transcript:FBtr0070489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNQRSRHVRRPAAEIVRELRNLRASPLRIDDENESWVNGYEKPPTPDLPVTSRDQLELL
RLSRHRIGLLLVRPAFEQAVTGCFVRVNVSGQGELPDHRIAEVLGICELDFGYKVEQIPT
NVALRLRYDDLEMQHEINDVSNLNFTQEEFELWRDNCVNQAISPPTTHILTRKKVELYNA
LQLEAKPLSLIQRTFSFALRPQQKIGIMERHGVVYPWQLNHSLPFVSQSPTENPSRGKAD
TVDEEEDPGAAAPLLPKTEPN
Download sequence
Identical sequences Q9V3X3
7227.FBpp0070467 FBpp0070467 FBpp0070467 NP_570030.1.81976 FBpp0070467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]