SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0071731 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0071731
Domain Number 1 Region: 430-559
Classification Level Classification E-value
Superfamily Plus3-like 4.71e-42
Family Plus3 0.00000488
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0071731   Gene: FBgn0034722   Transcript: FBtr0071820
Sequence length 775
Comment pep:known chromosome:BDGP5:2R:18262597:18265352:1 gene:FBgn0034722 transcript:FBtr0071820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGKRRTQSLIDSNSSDSDSESETNLESDLMSLAKKRKKPQTAAKSSSRSDSDSDWANNKA
GAPSSKKKKRQKPSRDSSSSESNWDDDSQDERQPARQSPAQTQQEHKPPEQASQPAQLSE
QEEGEVSDSDSDKSKSNSSSSGSDSSSSSSSSDSEFDDGFDDDLMGDDEDRRRLNGLSEK
ERETEIYKRIEQREIMRTRWEIERKLKLARRGEKNQEKSKNKGERAKKKKEKREKKARKA
REAQAPLPTQASTSTLLDVEPKPSNEVRSASPLSTPALNRDAASTSAAVASIMPDDAASS
AGVSDYFDHKERSKERKKNVEANKTDDKRSNAMALLKAKREGKAKREEEEAKRMAEKDRD
DDKEELDSVSGCKSAVKLKASEIYSDDSGSSDWDEEEKPAGKRSRSNSSKASSESEDEEK
APQRPVFITTREDLNKLRLSRYKMERFVNLPIFESTVLNCFVRISIGNNGQKPVYRVAEI
VGVVETGKIYSLGTTRTNRGLRLKHGTQERVFRLEFISNQEFTENEFNKWNEVCQQSHVQ
MPTIDLIAIKQNDIKKALNYEFKDEDVDKIVEEKNRFRNRPTNYAMKKTCLMKERDAAML
RGDYDIAQDLGQQIDELENRASELDKRRSHTLNLISYINDRNRKKNVEDAEKAILEEARA
NKGLKISDPFTRRITQPRMGFKGAKKDEDDMQLAPLPPPPPGKKRPNEAGTSSASVRSTD
SKDYSLYSLHDFDIDLDVPLPVNTNSVPKPASKPAETVSKRSLNLEDYKKKRGLI
Download sequence
Identical sequences H0RNK7 Q9W261
NP_001286717.1.81976 NP_611665.1.81976 FBpp0071731 FBpp0071731 7227.FBpp0071731 FBpp0071731

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]