SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0075809 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  FBpp0075809
Domain Number - Region: 302-377
Classification Level Classification E-value
Superfamily BEACH domain 0.0628
Family BEACH domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0075809   Gene: FBgn0052095   Transcript: FBtr0076077
Sequence length 429
Comment pep:known chromosome:BDGP5:3L:11817307:11818832:-1 gene:FBgn0052095 transcript:FBtr0076077 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARLIRIHLKHVETTVLLLRRRTQQRTRRRFRMLRTFFMRQMMEMHSNYLHTYAMLRLKH
SQVVDTESETSDVDEEPHDKIGVPCTFPSFDSHFFEHVIPELSEEDFLNTLHVTRGTFET
LCKQLSPTLRTSDELTQREPAISTEKCVALALNFLASGERLSLIAERFSLPRPRTIKCLK
VFCNAVMSTLGRALRQLPQNPVDCNSVAKGFQRESNMPAALVGVLGVCSIPIRSTGEAKN
SILRMEYLLDDRMLFRELQLGCGLRATLGPMFSHAPNTLTAIPEFRINSRLVPAFVLAPV
YQNYPLRPWLLQRYTDPTAPHEHDFNEVAEHLQELSDCALHRLMSRWSFLSQPLDISFHT
ASCIITAAAVLHNLLEELSEPHMLEWGNSVDVSKFRAEPLSDSVSEDAESHAALEVRDFL
ARTISSTEI
Download sequence
Identical sequences Q95U65
7227.FBpp0075809 NP_729755.1.81976 FBpp0075809 FBpp0075809 FBpp0075809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]