SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0078775 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0078775
Domain Number 1 Region: 2631-2918
Classification Level Classification E-value
Superfamily BEACH domain 3.27e-124
Family BEACH domain 0.0000000263
Further Details:      
 
Domain Number 2 Region: 2993-3194,3380-3408
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.71e-32
Family WD40-repeat 0.002
Further Details:      
 
Domain Number 3 Region: 2469-2597
Classification Level Classification E-value
Superfamily PH domain-like 3.38e-22
Family PreBEACH PH-like domain 0.0092
Further Details:      
 
Domain Number 4 Region: 3418-3483
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 1.58e-19
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0014
Further Details:      
 
Domain Number 5 Region: 227-298,438-562,589-625
Classification Level Classification E-value
Superfamily ARM repeat 0.0000000115
Family HspBP1 domain 0.046
Further Details:      
 
Weak hits

Sequence:  FBpp0078775
Domain Number - Region: 1065-1201
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.000776
Family Laminin G-like module 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0078775   Gene: FBgn0043362   Transcript: FBtr0079144
Sequence length 3489
Comment pep:known chromosome:BDGP5:2L:5907169:5922776:1 gene:FBgn0043362 transcript:FBtr0079144 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVMRKLRGAASAGSVSGSSSGTSTANNSSPGSSRTDAGAPTAANGRNAEEALMDARVQV
SLTTLKKLFNEYTHPREPLSEQERDDKLYEMLPLFCKVFSSCPSNDMSEKFWDVVAFCQQ
VSRLMVSEIRKRASNQSTEAASIAIVKFLEVETTEETSSGWMLLATLNLLANGDVSLIQV
MTAAAVPSTLVKCLYLFFDLPIVEDDEPSADGGAVSEFNAHERRTLLQKVFVQLLVKLCS
YPYPAEELARMDDLTLLFSAITSPCPIHNIVWRKNAAEILTTISRNGLTDAVVSYIHSKG
CMALCVDNMQRLTFGNPLEIVEMFVTVFCFLKDSSQVSQILMDDFRASQGYVFLSDFLLK
FDNNRSQSLEIQAAIRNLVLMISSLCMCGFYELRPPASQFNTAFKLQNFQLPQATSRETC
VRNVYAFQVLQNVFLKSTTPALCCTILDAISRVYHSENANYFILESEQTLSSFAERIHMK
SPQIQEKFYDLLEFIVFQLNFVPCKELISLSLLLKHNQSTSCSILCLKTLLNILRHNAVF
KDVYREVGILEIFVGCLTRYAAHVQKITKGDESVVVELENESEEELFDTLGKHVLEALTM
LLGGGASNNAQLFREYGGAKCVHELVKFKHCRPQALGIVRELILSAGGDDDMLHILSLMH
SVSPLQVEFKIQILNMLLGCLKDSHRTRTVFRKVGGFVYVTSVFVSLDGSMALPQPDIPQ
QDLILLLQIVFQTLATAMRFEPANAKFFHQEISSSSLCDTLRLLGCFGGSSALQDYTGTY
EPQQSLLKYYHEIFSGDILSVSFSEDVPYPLSYVCIVFRLLYSIALDNFEAPNLSGIITL
FSDPPTTLRSPSKELAPPVHPSQLNLTQPSPEPRIVHPGVVLCMLQLLPAVEYDMAPLQA
VQLQVYLSEIIKSLVRSERNQQIMCDHGLAEKLLKLTRRALAEESHPLHVPMQYILERLA
AQALQPTELRQFLRLGEPLSCADIDLQQPYKLGGPVPLTRIKTLVSMTTPRDFRAHGSST
LPPFVELDMSAEGFGCLYLPSLAPQATATAGGTIDANSIGGIGAGDRIFPPQTGLTYSTW
FCVEKFSDPKTDPHCVRLLTLVRTIHNPREENLACLSILLSARDKAIVVSTQETLVTPRK
SIGDWEPEGSDDGIARIWCPDLLHEGQWHNLVVVLNRAVLKNSSLFLYLDGVPMHTQKLH
YIAQHPAAGNASLTSPTQIFGYIGTPPIWRRYSRLCWKQGVCHLIEDVLTQQTVQTIYQL
GPHYMGSLQAPQLGKQSESLAPLVPEDRVLLGLNAKAVSKLTLVKIRKVYSRADNKSIAK
QLNMNSHENATPIKILHNSAGHLAGAGRSLGGVVVGYLGVRVFSPHPVSAMIDTVGGCNV
LLGIIAMAQDVESLYAGVKALTCVVRSNRAAQAEMDRKRCYQTLGMFFKKKKHLLNSHIL
HLTFGLVGTVNSGQDMSAIPNVTAFQDLLCDLEIWHNAPNGLLRSLLEHLLELVVESSDK
KQNVKIMRDLQLLVKLLHIITQIQDHSTREILFSLLETLLGGQPRHTDLLLFGQYVAAKL
PHAHSGGLERAVLLPSMKNPAEDQDGGVAQNIYLRNRCLSLLHGLLFTPRNTVNYVICDD
ISKTLGMDWLLLFMQPHVHFTTVIIAVRILVVICANESFLVRFRDATHNGGYLRFTEMVS
QRKMLGLGAQQLNQRPTNGTGTVIVATPQNTIQHLPTQIAGEVRAAALNIPGFQLLEWLM
NHHLDVPELYFLITALIMGQPVKVLATEHTKFDLDRVWSFLWGAPVSANTQLPKLNICPE
GVCVLLAMVRGIVHGGECAPWLHSHPETIIQLLFSLYQNLTDFAPVMMTGDVVTSLVAVL
FPLASRPADSEPNSGASTPTDDTGSSFALPPPETLHGAPQPKLTAHPVCNCIIDFLRVIV
VDSLGLNMQGKPTPVIDLVLDAAPESAELPLQVQYQTQIIIALMDHLLAADVLVGEQAAL
PLVPLLQSQMQYIAPNVFYLTARIVDKLWQGCLARNPHDIFDFVIKLIVQAKRRSSSLSL
EHLHHSLNRSILFLLSRPTDDSRADQMSVLEALHKIIQHRLLIFGAGNHELEFIGCLTYC
LLQLTADMKIILEPATSRNTTWHVNPQTETAEPKDEDLNQLQGRNLIVGAAFRVWEELYV
CKKPAIEEVFKVSLTSPPPNSKAPDLQTTREQVMELASKLWFNYVEAERKATYRAPWELH
TQIQSKIQKVTGGLSRLTSRTKTKKEELVRTRSTLTREAAYESTGIHVQLIKDLLDLRAK
QYQQMLQHTQRYVYQDWVQSEMELTRERGLWGPTGSCSLDKWILDTTEGPHRMRKKTMRN
DVFYLHYPYRPELELADNRQLKYKVASSLDSKTYALHGPQQPRILAEAGEHHAMQQQSSL
EAVQSHRLETSSSTSTPPPMVLPKLVGHGSTPCPQESVDGNAPEDDEEEEDTSMTSDNET
FLRLLEEQEKISFMFRCARVQGLDTFEGLLLFGKEHCYIVDGFTLLKNREIRDIDTLPPG
AYEPIIPNSGGTSSTTSRAVSHKLRQCSKFAYEEIREVHKRRYLLQPIALEVFSEDGRNY
LLSFPRKVRNKVNQRFLALATALNDNAQQSVAGQKRTASVEQTAGIFSGLIGETSVTQRW
VRGEISNFQYLMHLNTLAGRSYNDLMQYPVFPWILADYDSEELDLTNPKTFRDFSRPMGA
QAEERLEQFQKRFKEWDDPHGETPPYHYGTHYSSAMIVCSYLVRLEPFSQPFLKLQGGHF
DLADRMFHSIKEAWLSASKLNMADVKELIPEFFYLPEFLSNFNNFDLGTKQNGETLNHVI
LPPWAKHDPREFIRLHRSALECDYVSQHLHLWIDLIFGCKQQGPAAVDAVNVFHHLFYEG
NVDIYNIDDPLKKNATIGFINNFGQIPKQLFKKAHPAKKMGGSRHSALIDPTSLIQGNST
VLQTDRLFFHNLDNLKPSLQPIKELKGPVGQILQPDKTVFAVEQNKVMMPPSYTKYIAWG
FADHSLRIGLYDTDRASFVSEASAQNSGEILTCACPNAKMIVTAGTSSVVTIWKFDANRK
SLAVKHSLHGHTDAVTCLAASAAYNVIVSGSRDGTAIVWDMTRFTFVRQLRGHAGVVAAV
SINELTGDIATCSATWLHVWSINGDALAMVNTCVGSADRMQQILCVAFSQIREWDQQNVI
ITGSTDGVVRMWSLEHTQVPIDRKLKRGTEVSSQDKPDTVSLEGKDNKDDKMSLMKQIKS
LSQSEEEMEIVKSASESSISEASQHSHGSSKSAEAGPKAEVQGERRKSSISGAKSLHEMK
SATVEGQGSSYDPKSNEDEHAIRPSKSDTSLTDGFVVIDNDRHKGDQILRKGFRWQRQLM
FRSKLTMHTAYDRKDNAEPASITALTVSKDHKILYVGDARGRIFSWSVTEQPGRGVADHW
LKDEGADQCVKCHVKFTLYERKHHCRNCGQVFCNKCSRFESEISRLRILKPVRVCQACYS
QLRTNSLDN
Download sequence
Identical sequences Q9VML2
FBpp0078775 FBpp0078775 7227.FBpp0078775 NP_608968.2.81976 FBpp0078775

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]