SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0079896 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0079896
Domain Number 1 Region: 330-588
Classification Level Classification E-value
Superfamily BEACH domain 8.76e-74
Family BEACH domain 0.0001
Further Details:      
 
Domain Number 2 Region: 1649-1950
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.97e-35
Family WD40-repeat 0.0024
Further Details:      
 
Weak hits

Sequence:  FBpp0079896
Domain Number - Region: 195-279
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000749
Family Protein kinases, catalytic subunit 0.024
Further Details:      
 
Domain Number - Region: 786-817,919-988,1211-1294,1332-1427
Classification Level Classification E-value
Superfamily ARM repeat 0.023
Family Armadillo repeat 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0079896   Gene: FBgn0032395   Transcript: FBtr0080312
Sequence length 1953
Comment pep:known chromosome:BDGP5:2L:12014304:12020938:-1 gene:FBgn0032395 transcript:FBtr0080312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDSEQIWPEIGVDPQHVCEAGGDGRFQVICDKAWLQSLERNRRLTHFPSWPLLDRRSYP
IGQLEHPWTRILVQTYRKQPQSRVYPLPRISGDAPSSELPLSYSQAVSFVAHSNFKQLWE
EAYRKYNGAHVRMCRSTPSAPSTKPPSGQGQLQPHDVVLKELIQRVYRCPVLHCQLDRDG
VSDSSNATSCSAGSCHANVLPALVAIETSTHISVFFYPPALECSLYDCITFSPALLGKNY
NKTLFVIYQILQLAKHLQGQGLFLGDLRLQDIVLRENLWLQVLPRLQCNLLDDDPAGEDM
SPLTPLVSEDLGEAREAQQALPSSSTMFDLRFAYDPAHFNLREYTEMWCNGQLSNFDYLT
ILNNACGRSLTNAAYHHIMPWVTDFSGRGGGAWRDLTKSKYRLNKGDVHLDLMYAHASQH
GSADGSYQAIGDQAPHHVSDFLSEITYFVYMARRTPQSILCAHVRPIWVPAEYPVSIQRL
QEWTPDECIPEFYSDPMIFKSIHEDLPDLELPAWATCPEDFICKHREALESQYVSERLHH
WIDLNFGYKLSGKAAVKSKNVCLTLVDQHRNLSQRGIVQLFASAHPPRRYATPWFSRTAP
RLSQLYASPAKRLAKSTENLQAESATGSSHLSLRLGDDGSSGSVHSSSASASASNFYAIT
NFIELPENYNPALLLHNLETLEAFYARTFPQQRASANPEEKMISSDLMFEQNSAEHSFTN
QLFASGDELPPKSKNLLREKRNCLQHLLNVRKERDLHVLGCLIIELFAMQRLRPLLMGNG
LTATFDSRLSACRTVAQLHRQELPKPVRRVVRLLLQLEQPGEEDQGLPQPPNPAQLLEPM
FSNLLLPFPSHYMAVYALVRSLHAFEANAVLLELQTHFSCKGGRECERYTEMDRQRVLFE
RKIAECKVMSCCAHVKRLLEPMSFAYEQFTPVELLLPHIIDLLRDERTSILTAWNLFDPI
AQALGVSQTQQHLLQPLLKLYDVESVSSPDDGGSNGSTNSGGHLRFSASSSFKSRKSVKL
YHHSFLLRLIVRFGLRCFLHHFIAPLIEAVGGYKEPEQGNGYHYHSGGSRRTSKNLNFAS
ENEVHQTEVAPEMKPDIEELFTFEDDHDRASTQDSKSIDSFDMRPSTSAASAEEARESDG
SPDKLVINELIYGARISPDKLSLKESQTPPALVPPPIGPRSPTIEIPMGPTAGGIRRSFQ
LSAIDCDIGSRKSVDSFDLISQAVEQLPPPAEESEAEASDSLQASVISRLSEAKAVQNNR
ISEMSAESLVWLSHRLGPVLTSRFITRNLLKLLSLCYVGQENLLPEVDDGGSSFNSSPDA
ANLNYFSIANARVVGDRSAARVLECLMSIAALYGENFLLLQYFPHISELISLCSKRITGS
LEGAIISSLQLLKYMVPCLTDASIMEHLQHIMLDAILLPILRLLSSTNLVMPSGYLGRSL
LARKFLDAIYALSVRLGSDMTREHLCQPLLNPFFLIFNKAFGLPNDFACDLANLSLVGGA
SQPERALEELRDVFGPELAHTAYLTFLRFLGEANMKRTLSNLDFVLTLCHEHEQPNGQSK
IQLATNVSSGQDVDSVDASCELAANSFGTQIVGNRLQVARNNVELIDMVAYKLDQMPKTR
HLKGNWLAYWRNETTRNEKDTQTLNLKQIRLQSFVGHTNSVRAIYALDNENSFISASKDK
TVKLWSLRSEGDGRKTSACQFTYTAHKKSINSLGFLESLRYVVSCDSGIHLWDPFIGRPL
SVLDAPRHSAVTVVKCLPSHSPLVIAGTAESTVKMVDARSCEYVNEWRVCNASLPNATVR
CLAVAPSGNWLAAGLSSGCIVQLDTRTGMVINSWRPMECDLLQLAAPSDQFLVSSALDHS
LAVWHALDGIMHYQLKPPPEPAHFLQSVGPSLVYATTGNRVGVYADVAHSHAFSTITKLR
SETFRGVLTSLAVLPLNRAFLAGNESGNIALLC
Download sequence
Identical sequences Q9VKD0
FBpp0079896 NP_609535.1.81976 7227.FBpp0079896 FBpp0079896 FBpp0079896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]