SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0084525 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0084525
Domain Number 1 Region: 309-366
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 4.45e-22
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00014
Further Details:      
 
Domain Number 2 Region: 6-48
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.0000000000000157
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.00056
Further Details:      
 
Weak hits

Sequence:  FBpp0084525
Domain Number - Region: 213-310
Classification Level Classification E-value
Superfamily ARM repeat 0.00046
Family GUN4-associated domain 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0084525   Gene: FBgn0011289   Transcript: FBtr0085155
Sequence length 366
Comment pep:known chromosome:BDGP5:3R:23079152:23082186:1 gene:FBgn0011289 transcript:FBtr0085155 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALCQTSVLKVYHAVIEDVITNVRDAFLDEGVDEQVLQEMKQVWRNKLLASKAVELSPDS
GDGSHPPPIVANNPKSHKAANAKAKKAAAATAVTSHQHIGGNSSMSSLVGLKSSAGMAAG
SGIRNGLVPIKQEVNSQNPPPLHPTSAASMMQKQQQAASSGQGSIPIVATLDPNRIMPVN
ITLPSPAGSASSESRVLTIQVPASALQENQLTQILTAHLISSIMSLPTTLASSVLQQHVN
AALSSANHQKTLAAAKQLDGALDSSDEDESEESDDNIDNDDDDDLDKDDDEDAEHEDAAE
EEPLNSEDDVTDEDSAEMFDTDNVIVCQYDKITRSRNKWKFYLKDGIMNMRGKDYVFQKS
NGDAEW
Download sequence
Identical sequences P52654
FBpp0084525 FBpp0084524 FBpp0084525 NP_476995.1.81976 7227.FBpp0084525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]