SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0085300 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0085300
Domain Number 1 Region: 101-224
Classification Level Classification E-value
Superfamily Plus3-like 1.15e-32
Family Plus3 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0085300   Gene: FBgn0051703   Transcript: FBtr0085946
Sequence length 439
Comment pep:known chromosome:BDGP5:2L:22102626:22104401:-1 gene:FBgn0051703 transcript:FBtr0085946 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDERLRTRRKIANKLESGGKTAHAFERLLAIRTIKLSKGKCSEDSAEQTKSSDDCKAQTR
KDVNIEVKETYSGDSSPNSESENTAQNDPQMNVESEERVSNLEQLSRAVLKRNDIKNLLG
KPIFAEAVIGSFVRLNVGKVYSIYETIALHQDSKDYRVDGKRTNLILVLRCGSEKRYSRI
DVVSNQPITQKEFLLWLETNLRNRCTLPTLNDIAKKQVQVKNACKYSYTETDVEKLIQDK
KEAGIKQNAAYRKISLIIERDMAAGMNDVEKVQVLEKKILEIDEEPRPQIEKTGQHRYQV
LSSTRGVHVPTIYRHELGVPSGGKSSFVKRTAKPEQHELEKYMRRKYKKSAVVSRSRFKK
AFEDCVDSSAMVNDIHMESQQKEGDVETETETEKGTEKDLHSQRLHTFNIELDTTGLVPF
HEIFPNVKFNSPWDEIMKG
Download sequence
Identical sequences Q8IME7
NP_724376.1.81976 FBpp0085300 FBpp0085300 FBpp0085300 7227.FBpp0085300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]