SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0110292 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0110292
Domain Number 1 Region: 3028-3328
Classification Level Classification E-value
Superfamily BEACH domain 1.06e-127
Family BEACH domain 0.00000000021
Further Details:      
 
Domain Number 2 Region: 3455-3709
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.71e-33
Family WD40-repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 2917-3023
Classification Level Classification E-value
Superfamily PH domain-like 5.33e-25
Family PreBEACH PH-like domain 0.0000224
Further Details:      
 
Domain Number 4 Region: 163-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-23
Family Clostridium neurotoxins, the second last domain 0.011
Further Details:      
 
Domain Number 5 Region: 650-762,839-961
Classification Level Classification E-value
Superfamily ARM repeat 0.000000132
Family Armadillo repeat 0.06
Further Details:      
 
Weak hits

Sequence:  FBpp0110292
Domain Number - Region: 59-138
Classification Level Classification E-value
Superfamily ARM repeat 0.00362
Family Armadillo repeat 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0110292   Gene: FBgn0086911   Transcript: FBtr0110993
Sequence length 3712
Comment pep:known chromosome:BDGP5:X:4979866:5145183:1 gene:FBgn0086911 transcript:FBtr0110993 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEIKRPDEIVRMTTADNLKFAVLIGLIEVGQVTNREVVNTVLHLLVGGEFDMELNFVI
QDAQNIKHMLELLDHCPPNLQAEIWSVFIAILRKSVRNLQACTDVGLIEHVLVRLQRSET
VVADLLIEMLGVLASYSITVKELKLLFGTMKATNGKWPRHSAKLLNVLRQMPHRNGPDVF
FSFPGRKGSAMVLPPLAKWPYENGFTFTTWFRLDPINSVNIEREKPYLYCFKTSKGVGYT
AHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLAS
STEMAWFVSTNDPFDKCYIGATPELDEERVFCGQMSAIYLFSEALTTQQICAMHRLGPGY
KSQFRFDNECYLNLPDNHKRVSHFQLLPATLGASALSGGSGSGTGSGTGNDASAAAAAAV
AAGQQQQLQLQFQILAAEQEARAIDWSDEKLDLNAAFVKIRAVLTARNAVTLAGSSSTGT
TAVATAAAAAAAAGAGAGTTAAATSAAAAAAATQNENDAAVGQQQHATHHHATAATGSAD
DPLGHLPTGNASSSSSSFEQLRRMSSVSSLNSMVGSADTEEVNQLKAVLYDGKLSNAIVF
MYNPVATDGQLCLQSSPKGNVSYFVHTPHALMLQDVKAVVTHSIHCTLNSIGGIQVLFPL
FSQLDMAHEGLGDIKRDPTLCSKLLGFICELVETSQTVQQHMIQNRGFLVISFMLQRSSR
EHLTLEVLGSFLNLTKYLVTCLSANSDLLLKQLLDHVLFNPALWIYTPANVQARLYSYLA
TEFLSDTQIYSNVRRVSTVLQTVHTLKYYYWVVNPRAKSGIIPKGLDGPRPAQKDILAIR
AYILLFLKQLIMIGNGVKEDELQSILNYLTTMHEDENLHDVLQMLISLMSEHPSSMVPAF
DVKHGVRSIFKLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLY
EESLSLPTYNVLYEIMTEHISQQILYTRHPEPESHYRLENPMILKVVATLIRQSKQTESL
IDVKKLFLQDMTLLCNSNRENRRTVLQMSVWQEWLIAMAYIHPKSSEEQKISDMVYSLFR
MLLHHAIKHEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYERQRTDNITDPALRQA
RPISTISGWEREELHQQQNGGSAAAVATNQTAAVKGSVSIASLEDVPPVVEEEVEELELE
EVEIQEGPITEETEQKSVIANISDVYNEQLKTDATCNGNLEDVKEEEPVQQQIGDLEKQP
EPSTPLGALRETLQLGDDMDVEELELATAKDALNAEQHVSRVLQASEAALNDCKMAVDDV
LQESSSVLKDEEIELAVNEVVQGVLNNEKKTQSQDNKDNKEQPGEQDVNVSLLNSKNLLN
NNNNNNNNSPSPTPTTATATAETEAETEVNANEIVSSTEAPKAETETSVAPEVETPETAK
PSPIVPSPVLATNQKTEDAANKLNNNEKLAEISASPEPPIVVETPEADLLQLSDSETKPN
KETEAEDSVALAVRDIVEQLIDKVIDATEAESASETKTETNNNEIPKKEKQTSEEPEDVE
TAETLAAAAKEIVQEVVEAALVMVQEESTQEKPEKGANSEEEKNEIGKEEILLQLEEKPA
STEVQETKIEGDLKKPEDPKGHSSVEPKTPNLEEPKPQETEQQKSQEVAEELPQKPEEQV
VAIVNQVLDTLVDDTVKAVAAEQTTQTSPAPEEQSPQILAMESPATSVRVKPTEVDSTTQ
TTPKNEAGSSLLVEQVQQVLQEDDAQQSAGMTIEDEDYSNQQAAAAVENANSSQLDANHY
GPGNPESKQQQQRSKSGSTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQV
WRSHSTKSVLDFVNSSENAIFVVNTVHLISQLADNLIIACGGLLPLLASATSPNSELDVL
EPTQGMPLEVAVSFLQRLVNMADVLIFATSLNFGELEAEKNMSSGGILRQCLRLVCTCAV
RNCLECKERTRYNVGALARDVPGAAHLQALIRGAQASPKNIVESITGQLSPVKDPEKLLQ
DMDVNRLRAVIYRDVEETKQAQFLSLAIVYFISVLMVSKYRDILEPPAEPQIQRQSPVLQ
RTAGGEAASARPLFPQWSHHVYPQFLPESHQNHNSNMQHQQQQQQQQQHQQQQHYYQQQQ
QQQVVHNHSHHHMTAAYYQQQQHQQVAAGQQQHSPTPLATHSTSSSASSTATSQPASSSS
LSSLASQSQQQSHRQLHKQQQQQQQQQQQQQPHYHPHQPHYGLINGHQQHPQLNGKHYAE
NGSTAGYHPHSHPHPHGGYMRNGDTSTLQQNGMPDYQAVGLMNGHGSGGTGNNNNSSLMN
NMRNLRNGGGANSSSSPPGSHQVIQGVATAGAVNANAAVGVGMGGAVGVGMGGVAGGLDG
GVVYKTSAINNNYRYNGRNASAGTGGRQIQDSDYEIIVVDENNPSVLADNDSHSSGPPSI
KSVDSDVGSLNMNSTENEVPEVESSSEILIDDHKPSHSNDESWTDVNLNEDAAVQAASAG
IVVGLVDNRGNVISDKHDPSHHNQQQQQQAGIIGQQQQHGSLGHSERGDKPDSEISVVRV
PDGYGGAGSGGGVNSGQGQGVPSNQRPRPEELPMKAPALVAQLPLTTPSREASLTQKLEI
ALGPVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVELVMLLCSQEW
QNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCA
QTLLERREEERMCDHLITAARRRDNVIASRLLEKVRNIMCNRHGAWGDSSSTSSGGAIVG
AVQKSPYWKLDAWEDDARRRKRMVQNPRGSSHPQATLKAALENGGPEDAILQTRDEFHTQ
IAVSRTHPSGQHNGELLDDAELLIEDRELDLDLTGPVNISTKARLIAPGLVAPGTVSITS
TEMFFEVDEEHPEFQKIDGEVLKYCDHLHGKWYFSEVRAIFSRRYLLQNVALEIFLASRT
SILFAFPDQHTVKKVIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQKWQRREIS
NFEYLMFLNTIAGRTYNDLNQYPIFPWVLTNYESKDLDLSLPSNYRDLSKPIGALNPSRR
AYFEERYESWDSDTIPPFHYGTHYSTAAFTLNWLVRVEPFTTMFLALQGGKFDYPDRLFS
SVSLSWKNCQRDTSDVKELIPEWYFLPEMFYNSSGYRLGHREDGALVDDIELPPWAKSPE
EFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAIRATNVFYYLTYEGSVDLDGVLDP
VMREAVENQIRNFGQTPSQLLMEPHPPRSSAMHLSPMMFSAMPEDLCQMLKFYQNSPVIH
ISANTYPQLSLPSVVTVTAGHQFAVNRWNCNYTASVQSPSYAESPQSPGSNQPLTIDPVL
AVHGTNNNSNAASRRHLGDNFSQMLKIRSNCFVTTVDSRFLIACGFWDNSFRVFATETAK
IVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDVPTPRA
TLTGHEQAVTSVVISAELGLVVSGSSNGPVLIHTTFGDLLRSLDPPAEFHSPELITMSRE
GFIVINYDKGNVAAYTINGKKLRHETHNDNLQCMLLSRDGEYLMTAGDRGIVEVWRTFNL
APLYAFPACNAGIRSLALTHDQKYLLAGLSTGSIIVFHIDFNRWHHEYQQRY
Download sequence
Identical sequences FBpp0110292 FBpp0110292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]