SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0271896 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0271896
Domain Number 1 Region: 123-278,310-450
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 4.95e-32
Family Tyrosine-dependent oxidoreductases 0.01
Further Details:      
 
Weak hits

Sequence:  FBpp0271896
Domain Number - Region: 37-128
Classification Level Classification E-value
Superfamily BEACH domain 0.00641
Family BEACH domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0271896   Gene: FBgn0034143   Transcript: FBtr0273388
Sequence length 620
Comment pep:known chromosome:BDGP5:2R:12482533:12492716:-1 gene:FBgn0034143 transcript:FBtr0273388 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPSLTPKSNYQNQQNISPQSVLSERASALAASWLKADPPQWPTYPSISLSPPTLLLAAPS
SNLSSKLAPPTNLEPYTMAVITEHGGTTSSPPENNNSIGNGKHRVNGHQLSTSLTIPEFF
AHKNIFVTGGTGFLGTVLIEALLDTHPDIGTIYVLVRGKRKFDPNERIRRLLQKPIFEKY
SEKTLSKVVPVVGELSEPNFGFGPELLQELIDRVNVIYHSAATIKFSSPLRTAIRTNLTG
TMRTIELAKQLKQLAAYIYCSTAFCNSNNRGLIAEEVYKSQFDPYEMMKMAEDDSAWEDF
TDQKCKGYIRDHPNTYTFTKNLSENLLMAEMSGLPAAIVRPSIVYGTLEHPMKGWVGNAN
SGHLGFLAGFVKGIFRTMCGNANAVIDIIPCDYVINSSLVMGWYVGTRKLEQPEIIHCTS
GEVNPLNLAEFCTIINDSVERHPPNSFVWKPVTKLRNGWRYNLFFYLFHLLPAMVFIIPE
KLFGIGMPQHTAYEYMRVFQKGTKAFDYFLDKDFRYSLKNALRISALIPESDRRRYNFDA
SQCDWSEFIDRCLIGIRRFYFKESAVTTDWHRNYWKVFNVLYYAGYVVIFAVLYFALTLT
LGLQIGLTLAVLIWGFLVWL
Download sequence
Identical sequences FBpp0271896 FBpp0271896 7227.FBpp0271896 FBpp0271896

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]