SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0288527 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288527
Domain Number 1 Region: 3038-3338
Classification Level Classification E-value
Superfamily BEACH domain 1.06e-127
Family BEACH domain 0.00000000021
Further Details:      
 
Domain Number 2 Region: 3465-3719
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.71e-33
Family WD40-repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 2927-3033
Classification Level Classification E-value
Superfamily PH domain-like 5.33e-25
Family PreBEACH PH-like domain 0.0000224
Further Details:      
 
Domain Number 4 Region: 163-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.46e-23
Family Clostridium neurotoxins, the second last domain 0.011
Further Details:      
 
Domain Number 5 Region: 650-762,849-968
Classification Level Classification E-value
Superfamily ARM repeat 0.000000337
Family Armadillo repeat 0.06
Further Details:      
 
Weak hits

Sequence:  FBpp0288527
Domain Number - Region: 59-138
Classification Level Classification E-value
Superfamily ARM repeat 0.00362
Family Armadillo repeat 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288527   Gene: FBgn0086911   Transcript: FBtr0290088
Sequence length 3722
Comment pep:known chromosome:BDGP5:X:4979866:5145183:1 gene:FBgn0086911 transcript:FBtr0290088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEIKRPDEIVRMTTADNLKFAVLIGLIEVGQVTNREVVNTVLHLLVGGEFDMELNFVI
QDAQNIKHMLELLDHCPPNLQAEIWSVFIAILRKSVRNLQACTDVGLIEHVLVRLQRSET
VVADLLIEMLGVLASYSITVKELKLLFGTMKATNGKWPRHSAKLLNVLRQMPHRNGPDVF
FSFPGRKGSAMVLPPLAKWPYENGFTFTTWFRLDPINSVNIEREKPYLYCFKTSKGVGYT
AHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLAS
STEMAWFVSTNDPFDKCYIGATPELDEERVFCGQMSAIYLFSEALTTQQICAMHRLGPGY
KSQFRFDNECYLNLPDNHKRVSHFQLLPATLGASALSGGSGSGTGSGTGNDASAAAAAAV
AAGQQQQLQLQFQILAAEQEARAIDWSDEKLDLNAAFVKIRAVLTARNAVTLAGSSSTGT
TAVATAAAAAAAAGAGAGTTAAATSAAAAAAATQNENDAAVGQQQHATHHHATAATGSAD
DPLGHLPTGNASSSSSSFEQLRRMSSVSSLNSMVGSADTEEVNQLKAVLYDGKLSNAIVF
MYNPVATDGQLCLQSSPKGNVSYFVHTPHALMLQDVKAVVTHSIHCTLNSIGGIQVLFPL
FSQLDMAHEGLGDIKRDPTLCSKLLGFICELVETSQTVQQHMIQNRGFLVISFMLQRSSR
EHLTLEVLGSFLNLTKYLVTCLSANSDLLLKQLFCFSFLTWQLLDHVLFNPALWIYTPAN
VQARLYSYLATEFLSDTQIYSNVRRVSTVLQTVHTLKYYYWVVNPRAKSGIIPKGLDGPR
PAQKDILAIRAYILLFLKQLIMIGNGVKEDELQSILNYLTTMHEDENLHDVLQMLISLMS
EHPSSMVPAFDVKHGVRSIFKLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLY
TLLAERLLLYEESLSLPTYNVLYEIMTEHISQQILYTRHPEPESHYRLENPMILKVVATL
IRQSKQTESLIDVKKLFLQDMTLLCNSNRENRRTVLQMSVWQEWLIAMAYIHPKSSEEQK
ISDMVYSLFRMLLHHAIKHEYGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYERQRTD
NITDPALRQARPISTISGWEREELHQQQNGGSAAAVATNQTAAVKGSVSIASLEDVPPVV
EEEVEELELEEVEIQEGPITEETEQKSVIANISDVYNEQLKTDATCNGNLEDVKEEEPVQ
QQIGDLEKQPEPSTPLGALRETLQLGDDMDVEELELATAKDALNAEQHVSRVLQASEAAL
NDCKMAVDDVLQESSSVLKDEEIELAVNEVVQGVLNNEKKTQSQDNKDNKEQPGEQDVNV
SLLNSKNLLNNNNNNNNNSPSPTPTTATATAETEAETEVNANEIVSSTEAPKAETETSVA
PEVETPETAKPSPIVPSPVLATNQKTEDAANKLNNNEKLAEISASPEPPIVVETPEADLL
QLSDSETKPNKETEAEDSVALAVRDIVEQLIDKVIDATEAESASETKTETNNNEIPKKEK
QTSEEPEDVETAETLAAAAKEIVQEVVEAALVMVQEESTQEKPEKGANSEEEKNEIGKEE
ILLQLEEKPASTEVQETKIEGDLKKPEDPKGHSSVEPKTPNLEEPKPQETEQQKSQEVAE
ELPQKPEEQVVAIVNQVLDTLVDDTVKAVAAEQTTQTSPAPEEQSPQILAMESPATSVRV
KPTEVDSTTQTTPKNEAGSSLLVEQVQQVLQEDDAQQSAGMTIEDEDYSNQQAAAAVENA
NSSQLDANHYGPGNPESKQQQQRSKSGSTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDV
LFSLETDIQVWRSHSTKSVLDFVNSSENAIFVVNTVHLISQLADNLIIACGGLLPLLASA
TSPNSELDVLEPTQGMPLEVAVSFLQRLVNMADVLIFATSLNFGELEAEKNMSSGGILRQ
CLRLVCTCAVRNCLECKERTRYNVGALARDVPGAAHLQALIRGAQASPKNIVESITGQLS
PVKDPEKLLQDMDVNRLRAVIYRDVEETKQAQFLSLAIVYFISVLMVSKYRDILEPPAEP
QIQRQSPVLQRTAGGEAASARPLFPQWSHHVYPQFLPESHQNHNSNMQHQQQQQQQQQHQ
QQQHYYQQQQQQQVVHNHSHHHMTAAYYQQQQHQQVAAGQQQHSPTPLATHSTSSSASST
ATSQPASSSSLSSLASQSQQQSHRQLHKQQQQQQQQQQQQQPHYHPHQPHYGLINGHQQH
PQLNGKHYAENGSTAGYHPHSHPHPHGGYMRNGDTSTLQQNGMPDYQAVGLMNGHGSGGT
GNNNNSSLMNNMRNLRNGGGANSSSSPPGSHQVIQGVATAGAVNANAAVGVGMGGAVGVG
MGGVAGGLDGGVVYKTSAINNNYRYNGRNASAGTGGRQIQDSDYEIIVVDENNPSVLADN
DSHSSGPPSIKSVDSDVGSLNMNSTENEVPEVESSSEILIDDHKPSHSNDESWTDVNLNE
DAAVQAASAGIVVGLVDNRGNVISDKHDPSHHNQQQQQQAGIIGQQQQHGSLGHSERGDK
PDSEISVVRVPDGYGGAGSGGGVNSGQGQGVPSNQRPRPEELPMKAPALVAQLPLTTPSR
EASLTQKLEIALGPVCPLLREIMVDFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVE
LVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVL
KHADFESQCAQTLLERREEERMCDHLITAARRRDNVIASRLLEKVRNIMCNRHGAWGDSS
STSSGGAIVGAVQKSPYWKLDAWEDDARRRKRMVQNPRGSSHPQATLKAALENGGPEDAI
LQTRDEFHTQIAVSRTHPSGQHNGELLDDAELLIEDRELDLDLTGPVNISTKARLIAPGL
VAPGTVSITSTEMFFEVDEEHPEFQKIDGEVLKYCDHLHGKWYFSEVRAIFSRRYLLQNV
ALEIFLASRTSILFAFPDQHTVKKVIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNM
TQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPIFPWVLTNYESKDLDLSLPSNYRDLSK
PIGALNPSRRAYFEERYESWDSDTIPPFHYGTHYSTAAFTLNWLVRVEPFTTMFLALQGG
KFDYPDRLFSSVSLSWKNCQRDTSDVKELIPEWYFLPEMFYNSSGYRLGHREDGALVDDI
ELPPWAKSPEEFVRINRMALESEFVSCQLHQWIDLIFGYKQRGPEAIRATNVFYYLTYEG
SVDLDGVLDPVMREAVENQIRNFGQTPSQLLMEPHPPRSSAMHLSPMMFSAMPEDLCQML
KFYQNSPVIHISANTYPQLSLPSVVTVTAGHQFAVNRWNCNYTASVQSPSYAESPQSPGS
NQPLTIDPVLAVHGTNNNSNAASRRHLGDNFSQMLKIRSNCFVTTVDSRFLIACGFWDNS
FRVFATETAKIVQIVFGHFGVVTCMARSECNITSDCYIASGSADCTVLLWHWNARTQSIV
GEGDVPTPRATLTGHEQAVTSVVISAELGLVVSGSSNGPVLIHTTFGDLLRSLDPPAEFH
SPELITMSREGFIVINYDKGNVAAYTINGKKLRHETHNDNLQCMLLSRDGEYLMTAGDRG
IVEVWRTFNLAPLYAFPACNAGIRSLALTHDQKYLLAGLSTGSIIVFHIDFNRWHHEYQQ
RY
Download sequence
Identical sequences FBpp0288527 7227.FBpp0288527 FBpp0288527 FBpp0288527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]