SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0288863 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288863
Domain Number 1 Region: 2894-3194
Classification Level Classification E-value
Superfamily BEACH domain 1.01e-127
Family BEACH domain 0.00000000021
Further Details:      
 
Domain Number 2 Region: 3321-3575
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.45e-33
Family WD40-repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 2783-2889
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-25
Family PreBEACH PH-like domain 0.0000224
Further Details:      
 
Domain Number 4 Region: 3-155
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.58e-21
Family Clostridium neurotoxins, the second last domain 0.011
Further Details:      
 
Domain Number 5 Region: 460-572,649-771
Classification Level Classification E-value
Superfamily ARM repeat 0.000000127
Family Armadillo repeat 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288863   Gene: FBgn0086911   Transcript: FBtr0299588
Sequence length 3578
Comment pep:known chromosome:BDGP5:X:5117862:5145183:1 gene:FBgn0086911 transcript:FBtr0299588 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVLPPLAKWPYENGFTFTTWFRLDPINSVNIEREKPYLYCFKTSKGVGYTAHFVGNCLVL
TSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLASSTEMAWFVST
NDPFDKCYIGATPELDEERVFCGQMSAIYLFSEALTTQQICAMHRLGPGYKSQFRFDNEC
YLNLPDNHKRVSHFQLLPATLGASALSGGSGSGTGSGTGNDASAAAAAAVAAGQQQQLQL
QFQILAAEQEARAIDWSDEKLDLNAAFVKIRAVLTARNAVTLAGSSSTGTTAVATAAAAA
AAAGAGAGTTAAATSAAAAAAATQNENDAAVGQQQHATHHHATAATGSADDPLGHLPTGN
ASSSSSSFEQLRRMSSVSSLNSMVGSADTEEVNQLKAVLYDGKLSNAIVFMYNPVATDGQ
LCLQSSPKGNVSYFVHTPHALMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLDMAHEG
LGDIKRDPTLCSKLLGFICELVETSQTVQQHMIQNRGFLVISFMLQRSSREHLTLEVLGS
FLNLTKYLVTCLSANSDLLLKQLLDHVLFNPALWIYTPANVQARLYSYLATEFLSDTQIY
SNVRRVSTVLQTVHTLKYYYWVVNPRAKSGIIPKGLDGPRPAQKDILAIRAYILLFLKQL
IMIGNGVKEDELQSILNYLTTMHEDENLHDVLQMLISLMSEHPSSMVPAFDVKHGVRSIF
KLLAAESQLIRLQALKLLGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLYEESLSLPTYN
VLYEIMTEHISQQILYTRHPEPESHYRLENPMILKVVATLIRQSKQTESLIDVKKLFLQD
MTLLCNSNRENRRTVLQMSVWQEWLIAMAYIHPKSSEEQKISDMVYSLFRMLLHHAIKHE
YGGWRVWVDTLAIVHSKVSYEEFKLQFAQMYEHYERQRTDNITDPALRQARPISTISGWE
REELHQQQNGGSAAAVATNQTAAVKGSVSIASLEDVPPVVEEEVEELELEEVEIQEGPIT
EETEQKSVIANISDVYNEQLKTDATCNGNLEDVKEEEPVQQQIGDLEKQPEPSTPLGALR
ETLQLGDDMDVEELELATAKDALNAEQHVSRVLQASEAALNDCKMAVDDVLQESSSVLKD
EEIELAVNEVVQGVLNNEKKTQSQDNKDNKEQPGEQDVNVSLLNSKNLLNNNNNNNNNSP
SPTPTTATATAETEAETEVNANEIVSSTEAPKAETETSVAPEVETPETAKPSPIVPSPVL
ATNQKTEDAANKLNNNEKLAEISASPEPPIVVETPEADLLQLSDSETKPNKETEAEDSVA
LAVRDIVEQLIDKVIDATEAESASETKTETNNNEIPKKEKQTSEEPEDVETAETLAAAAK
EIVQEVVEAALVMVQEESTQEKPEKGANSEEEKNEIGKEEILLQLEEKPASTEVQETKIE
GDLKKPEDPKGHSSVEPKTPNLEEPKPQETEQQKSQEVAEELPQKPEEQVVAIVNQVLDT
LVDDTVKAVAAEQTTQTSPAPEEQSPQILAMESPATSVRVKPTEVDSTTQTTPKNEAGSS
LLVEQVQQVLQEDDAQQSAGMTIEDEDYSNQQAAAAVENANSSQLDANHYGPGNPESKQQ
QQRSKSGSTRPMFSPGPTRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQVWRSHSTKSVL
DFVNSSENAIFVVNTVHLISQLADNLIIACGGLLPLLASATSPNSELDVLEPTQGMPLEV
AVSFLQRLVNMADVLIFATSLNFGELEAEKNMSSGGILRQCLRLVCTCAVRNCLECKERT
RYNVGALARDVPGAAHLQALIRGAQASPKNIVESITGQLSPVKDPEKLLQDMDVNRLRAV
IYRDVEETKQAQFLSLAIVYFISVLMVSKYRDILEPPAEPQIQRQSPVLQRTAGGEAASA
RPLFPQWSHHVYPQFLPESHQNHNSNMQHQQQQQQQQQHQQQQHYYQQQQQQQVVHNHSH
HHMTAAYYQQQQHQQVAAGQQQHSPTPLATHSTSSSASSTATSQPASSSSLSSLASQSQQ
QSHRQLHKQQQQQQQQQQQQQPHYHPHQPHYGLINGHQQHPQLNGKHYAENGSTAGYHPH
SHPHPHGGYMRNGDTSTLQQNGMPDYQAVGLMNGHGSGGTGNNNNSSLMNNMRNLRNGGG
ANSSSSPPGSHQVIQGVATAGAVNANAAVGVGMGGAVGVGMGGVAGGLDGGVVYKTSAIN
NNYRYNGRNASAGTGGRQIQDSDYEIIVVDENNPSVLADNDSHSSGPPSIKANQTTTIAT
TTTTTATTHINNNNTKTTTSNAPTATIKIQQQPLSPPKPLVPQKLPKSVDSDVGSLNMNS
TENEVPEVESSSEILIDDHKPSHSNDESWTDVNLNEDAAVQAASAGIVVGLVDNRGNVIS
DKHDPSHHNQQQQQQAGIIGQQQQHGSLGHSERGDKPDSEISVVRVPDGYGGAGSGGGVN
SGQGQGVPSNQRPRPEELPMKAPALVAQLPLTTPSREASLTQKLEIALGPVCPLLREIMV
DFAPFLSKTLVGSHGQELLMEGKGLTTFKNSHSVVELVMLLCSQEWQNSLQKHAGLAFIE
LINEGRLLSHAMKDHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCD
HLITAARRRDNVIASRLLEKVRNIMCNRHGAWGDSSSTSSGGAIVGAVQKSPYWKLDAWE
DDARRRKRMVQNPRGSSHPQATLKAALENGGPEDAILQTRDEFHTQIAVSRTHPSGQHNG
ELLDDAELLIEDRELDLDLTGPVNISTKARLIAPGLVAPGTVSITSTEMFFEVDEEHPEF
QKIDGEVLKYCDHLHGKWYFSEVRAIFSRRYLLQNVALEIFLASRTSILFAFPDQHTVKK
VIKALPRVGVGIKYGIPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGR
TYNDLNQYPIFPWVLTNYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDSDT
IPPFHYGTHYSTAAFTLNWLVRVEPFTTMFLALQGGKFDYPDRLFSSVSLSWKNCQRDTS
DVKELIPEWYFLPEMFYNSSGYRLGHREDGALVDDIELPPWAKSPEEFVRINRMALESEF
VSCQLHQWIDLIFGYKQRGPEAIRATNVFYYLTYEGSVDLDGVLDPVMREAVENQIRNFG
QTPSQLLMEPHPPRSSAMHLSPMMFSAMPEDLCQMLKFYQNSPVIHISANTYPQLSLPSV
VTVTAGHQFAVNRWNCNYTASVQSPSYAESPQSPGSNQPLTIDPVLAVHGTNNNSNAASR
RHLGDNFSQMLKIRSNCFVTTVDSRFLIACGFWDNSFRVFATETAKIVQIVFGHFGVVTC
MARSECNITSDCYIASGSADCTVLLWHWNARTQSIVGEGDVPTPRATLTGHEQAVTSVVI
SAELGLVVSGSSNGPVLIHTTFGDLLRSLDPPAEFHSPELITMSREGFIVINYDKGNVAA
YTINGKKLRHETHNDNLQCMLLSRDGEYLMTAGDRGIVEVWRTFNLAPLYAFPACNAGIR
SLALTHDQKYLLAGLSTGSIIVFHIDFNRWHHEYQQRY
Download sequence
Identical sequences FBpp0288863 FBpp0288863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]