SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0288864 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0288864
Domain Number 1 Region: 2821-3121
Classification Level Classification E-value
Superfamily BEACH domain 9.81e-128
Family BEACH domain 0.00000000021
Further Details:      
 
Domain Number 2 Region: 3248-3502
Classification Level Classification E-value
Superfamily WD40 repeat-like 4.45e-33
Family WD40-repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 2710-2816
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-25
Family PreBEACH PH-like domain 0.0000224
Further Details:      
 
Domain Number 4 Region: 163-345
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.34e-23
Family Clostridium neurotoxins, the second last domain 0.011
Further Details:      
 
Domain Number 5 Region: 443-555,632-751
Classification Level Classification E-value
Superfamily ARM repeat 0.000000132
Family PBS lyase HEAT-like repeat 0.079
Further Details:      
 
Weak hits

Sequence:  FBpp0288864
Domain Number - Region: 39-141
Classification Level Classification E-value
Superfamily ARM repeat 0.0499
Family Armadillo repeat 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0288864   Gene: FBgn0086911   Transcript: FBtr0299589
Sequence length 3505
Comment pep:known chromosome:BDGP5:X:4979866:5145183:1 gene:FBgn0086911 transcript:FBtr0299589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSEIKRPDEIVRMTTADNLKFAVLIGLIEVGQVTNREVVNTVLHLLVGGEFDMELNFVI
QDAQNIKHMLELLDHCPPNLQAEIWSVFIAILRKSVRNLQACTDVGLIEHVLVRLQRSET
VVADLLIEMLGVLASYSITVKELKLLFGTMKATNGKWPRHSAKLLNVLRQMPHRNGPDVF
FSFPGRKGSAMVLPPLAKWPYENGFTFTTWFRLDPINSVNIEREKPYLYCFKTSKGVGYT
AHFVGNCLVLTSMKVKGKGFQHCVKYEFQPRKWYMIAIVYIYNRWTKSEIKCLVNGQLAS
STEMAWFVSTNDPFDKCYIGATPELDEERVFCGQMSAIYLFSEALTTQQICAMHRLGPGY
KSQFRFDNECYLNLPDNHKRVLYDGKLSNAIVFMYNPVATDGQLCLQSSPKGNVSYFVHT
PHALMLQDVKAVVTHSIHCTLNSIGGIQVLFPLFSQLDMAHEGLGDIKRDPTLCSKLLGF
ICELVETSQTVQQHMIQNRGFLVISFMLQRSSREHLTLEVLGSFLNLTKYLVTCLSANSD
LLLKQLLDHVLFNPALWIYTPANVQARLYSYLATEFLSDTQIYSNVRRVSTVLQTVHTLK
YYYWVVNPRAKSGIIPKGLDGPRPAQKDILAIRAYILLFLKQLIMIGNGVKEDELQSILN
YLTTMHEDENLHDVLQMLISLMSEHPSSMVPAFDVKHGVRSIFKLLAAESQLIRLQALKL
LGFFLSRSTHKRKYDVMSPHNLYTLLAERLLLYEESLSLPTYNVLYEIMTEHISQQILYT
RHPEPESHYRLENPMILKVVATLIRQSKQTESLIDVKKLFLQDMTLLCNSNRENRRTVLQ
MSVWQEWLIAMAYIHPKSSEEQKISDMVYSLFRMLLHHAIKHEYGGWRVWVDTLAIVHSK
VSYEEFKLQFAQMYEHYERQRTDNITDPALRQARPISTISGWEREELHQQQNGGSAAAVA
TNQTAAVKGSVSIASLEDVPPVVEEEVEELELEEVEIQEGPITEETEQKSVIANISDVYN
EQLKTDATCNGNLEDVKEEEPVQQQIGDLEKQPEPSTPLGALRETLQLGDDMDVEELELA
TAKDALNAEQHVSRVLQASEAALNDCKMAVDDVLQESSSVLKDEEIELAVNEVVQGVLNN
EKKTQSQDNKDNKEQPGEQDVNVSLLNSKNLLNNNNNNNNNSPSPTPTTATATAETEAET
EVNANEIVSSTEAPKAETETSVAPEVETPETAKPSPIVPSPVLATNQKTEDAANKLNNNE
KLAEISASPEPPIVVETPEADLLQLSDSETKPNKETEAEDSVALAVRDIVEQLIDKVIDA
TEAESASETKTETNNNEIPKKEKQTSEEPEDVETAETLAAAAKEIVQEVVEAALVMVQEE
STQEKPEKGANSEEEKNEIGKEEILLQLEEKPASTEVQETKIEGDLKKPEDPKGHSSVEP
KTPNLEEPKPQETEQQKSQEVAEELPQKPEEQVVAIVNQVLDTLVDDTVKAVAAEQTTQT
SPAPEEQSPQILAMESPATSVRVKPTEVDSTTQTTPKNEAGSSLLVEQVQQVLQEDDAQQ
SAGMTIEDEDYSNQQAAAAVENANSSQLDANHYGPGNPESKQQQQRSKSGSTRPMFSPGP
TRPPFRIPEFKWSYIHQRLLSDVLFSLETDIQVWRSHSTKSVLDFVNSSENAIFVVNTVH
LISQLADNLIIACGGLLPLLASATSPNSELDVLEPTQGMPLEVAVSFLQRLVNMADVLIF
ATSLNFGELEAEKNMSSGGILRQCLRLVCTCAVRNCLECKERTRYNVGALARDVPGAAHL
QALIRGAQASPKNIVESITGQLSPVKDPEKLLQDMDVNRLRAVIYRDVEETKQAQFLSLA
IVYFISVLMVSKYRDILEPPAEPQIQRQSPVLQRTAGGEAASARPLFPQWSHHVYPQFLP
ESHQNHNSNMQHQQQQQQQQQHQQQQHYYQQQQQQQVVHNHSHHHMTAAYYQQQQHQQVA
AGQQQHSPTPLATHSTSSSASSTATSQPASSSSLSSLASQSQQQSHRQLHKQQQQQQQQQ
QQQQPHYHPHQPHYGLINGHQQHPQLNGKHYAENGSTAGYHPHSHPHPHGGYMRNGDTST
LQQNGMPDYQAVGLMNGHGSGGTGNNNNSSLMNNMRNLRNGGGANSSSSPPGSHQVIQGV
ATAGAVNANAAVGVGMGGAVGVGMGGVAGGLDGGVVYKTSAINNNYRYNGRNASAGTGGR
QIQDSDYEIIVVDENNPSVLADNDSHSSGPPSIKSVDSDVGSLNMNSTENEVPEVESSSE
ILIDDHKPSHSNDESWTDVNLNEDAAVQAASAGIVVGLVDNRGNVISDKHDPSHHNQQQQ
QQAGIIGQQQQHGSLGHSERGDKPDSEISVVRVPDGYGGAGSGGGVNSGQGQGVPSNQRP
RPEELPMKAPALVAQLPLTTPSREASLTQKLEIALGPVCPLLREIMVDFAPFLSKTLVGS
HGQELLMEGKGLTTFKNSHSVVELVMLLCSQEWQNSLQKHAGLAFIELINEGRLLSHAMK
DHIVRVANEAEFILNRMRADDVLKHADFESQCAQTLLERREEERMCDHLITAARRRDNVI
ASRLLEKVRNIMCNRHGAWGDSSSTSSGGAIVGAVQKSPYWKLDAWEDDARRRKRMVQNP
RGSSHPQATLKAALENGGPEDAILQTRDEFHTQIAVSRTHPSGQHNGELLDDAELLIEDR
ELDLDLTGPVNISTKARLIAPGLVAPGTVSITSTEMFFEVDEEHPEFQKIDGEVLKYCDH
LHGKWYFSEVRAIFSRRYLLQNVALEIFLASRTSILFAFPDQHTVKKVIKALPRVGVGIK
YGIPQTRRASMMSPRQLMRNSNMTQKWQRREISNFEYLMFLNTIAGRTYNDLNQYPIFPW
VLTNYESKDLDLSLPSNYRDLSKPIGALNPSRRAYFEERYESWDSDTIPPFHYGTHYSTA
AFTLNWLVRVEPFTTMFLALQGGKFDYPDRLFSSVSLSWKNCQRDTSDVKELIPEWYFLP
EMFYNSSGYRLGHREDGALVDDIELPPWAKSPEEFVRINRMALESEFVSCQLHQWIDLIF
GYKQRGPEAIRATNVFYYLTYEGSVDLDGVLDPVMREAVENQIRNFGQTPSQLLMEPHPP
RSSAMHLSPMMFSAMPEDLCQMLKFYQNSPVIHISANTYPQLSLPSVVTVTAGHQFAVNR
WNCNYTASVQSPSYAESPQSPGSNQPLTIDPVLAVHGTNNNSNAASRRHLGDNFSQMLKI
RSNCFVTTVDSRFLIACGFWDNSFRVFATETAKIVQIVFGHFGVVTCMARSECNITSDCY
IASGSADCTVLLWHWNARTQSIVGEGDVPTPRATLTGHEQAVTSVVISAELGLVVSGSSN
GPVLIHTTFGDLLRSLDPPAEFHSPELITMSREGFIVINYDKGNVAAYTINGKKLRHETH
NDNLQCMLLSRDGEYLMTAGDRGIVEVWRTFNLAPLYAFPACNAGIRSLALTHDQKYLLA
GLSTGSIIVFHIDFNRWHHEYQQRY
Download sequence
Identical sequences FBpp0288864 FBpp0288864

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]