SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0289915 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0289915
Domain Number 1 Region: 88-371
Classification Level Classification E-value
Superfamily Clavaminate synthase-like 1.92e-47
Family Asparaginyl hydroxylase-like 0.063
Further Details:      
 
Domain Number 2 Region: 1084-1310
Classification Level Classification E-value
Superfamily RNI-like 2.16e-27
Family 28-residue LRR 0.069
Further Details:      
 
Domain Number 3 Region: 757-807
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0001
Family Rubredoxin 0.012
Further Details:      
 
Weak hits

Sequence:  FBpp0289915
Domain Number - Region: 837-876
Classification Level Classification E-value
Superfamily BEACH domain 0.0536
Family BEACH domain 0.014
Further Details:      
 
Domain Number - Region: 692-738
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0607
Family Cytochrome c3-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0289915   Gene: FBgn0037659   Transcript: FBtr0300691
Sequence length 1345
Comment pep:known chromosome:BDGP5:3R:4878240:4888967:1 gene:FBgn0037659 transcript:FBtr0300691 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTAVETGSSPAKSNSNNSSSGGNNNNGNGNLSPNAKGVQRRQLRERKQRKLYLEEWSLG
DEDGEGTRGFSVAEKLESSKFAQAGMVREMRGCDLTVAFLQQHGFNIPLLFRDKAGLGLR
MPDPQEFTVNDVRLCVGSRRLLDVMDVNTQKNLQMTMKEWQQYYDSPQKDRLLNVISLEF
SHTRLDRFVQSPEIVRQIDWVDVVWPKQLKDAQREGTNLLGGMMYPKVQKYCLMSVKNCY
TDFHIDFGGTSVWYHILRGSKVFWLIPPTDRNLQLYEKWVLSGKQADIFFGDTVEKCARV
YLTAGNTFFIPTGWIHAVYTPTQSLVFGGNFLHSFGIVKQLKTASVEDSTKVPQKFRYPF
FTEMLWYVLARYVHTLLGHSHLEGEASLSEDEMAARPHTHLTHHELFGLKEIVMYLYDLP
PQKKNVPSLVLDPVALIKDVRSLVERHCKDQQDLAITGVSVLKSPPGSQPPFLLYDRTRV
KQEIKQEIARKNAEVIREQQQLEAGRAREAESDTSQSTGVGSVIGMGAGVEYSNGVMKKE
QLENGSGVTVGGHGSQPEATFALPTDTLKYRPPKKMHLATALVAAAASSSSGGGGPVAGV
GGSAVVGSSHSPTGGGVGPVTGAGGAISVIATSSSYIEGGQVGGILNMDNCHSPEGGGAK
LSPNLTGTGQPRRRRTRCKNCAACQRSDCGTCPFCMDMVKFGGPGRAKQTCMMRQCLSPM
LPVTAQCVYCHLDGWRQTPVSPQTKQLASADGPSALMECSVCYEIAHPDCALSQLDGTED
AADAKGIVNEDLPNSWECPSCCRSGKNYDYKPRHFRARQKSSEVRRVSVSHGQGGAEGHA
DGNTLLPPPVGQYNDFVFTSESEMESGTVSGHMTHWKHGMKRHHQLEVKTERNNSCDTPS
PGISPNAIGGDSKVGKRRKSDDGTSVSSSMHESNDAPCGSSAEGAGGAGNANVSTNQWSG
SGGGGGSRKKNSIRSQLAQQMLNSSTRVLKKPQYVVRPASGTGSSSSSGNGGSASATNGI
SNGSNQSGANSCGAGNGERGTNNGGLSGSNGLGNQHYSSSQNLALDPTVLKIIFRYLPQD
TLVTCCSVCKVWSNAAVDPDLWKKMNCSEHKMSASLLTAIVRRQPEHLILDWTQIAKRQL
AWLVARLPALKNLSLQNCPIQAVLALHTCLCPPLQTLDLSFVRGLNDAAIRDILSPPKDS
RPGLSDSKTRLRDLKVMKLAGTDISDVAVRYITQSLPYLRHLDLSSCQRITDAGVAQIGT
STTATARLTELNLSACRLVSENALEHLAKCEGLIWLDLRHVPQVSTQSVIRFASNSKHDL
CVRDIKLVERRRRNSTTANRSWHHD
Download sequence
Identical sequences A0A0B4KFJ7 Q9VHH9
NP_001262400.1.81976 NP_001262401.1.81976 NP_001262402.1.81976 NP_649864.2.81976 FBpp0289915 FBpp0289915 FBpp0289915

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]