SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0292327 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0292327
Domain Number 1 Region: 10-258
Classification Level Classification E-value
Superfamily CutC-like 1.83e-60
Family CutC-like 0.00000745
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0292327   Gene: FBgn0038332   Transcript: FBtr0303235
Sequence length 263
Comment pep:known chromosome:BDGP5:3R:11196537:11197934:-1 gene:FBgn0038332 transcript:FBtr0303235 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIREMSNHDIKLEVCVDSIRSAFAAEEGGASRIELCSALGEGGLTPSIGTLKTIKETLTM
PIYCMLRPRRGTDFVYSDEEMCALLTDMDLLRENGADGFVFGSLNPDRSINVDQCRHVLL
ASGGLPVTFHRAFDLTDQKSMDENVDMLRELGFRRLLSSGFRPTAADGVDCLAQLIAKHQ
RDFIVMPGAGIKVSNLEEILTVSRCLEFHASALDTAGEDYVAPTTTRMECDVTMGKQDVD
PYYGTNSIVVRKMVTIAKAMSSR
Download sequence
Identical sequences A0A0B4JDE8 Q9VF71
NP_001189224.1.81976 NP_001262600.1.81976 NP_650460.1.81976 FBpp0292327 FBpp0292327 FBpp0292328 FBpp0292327 FBpp0292328 FBpp0304807 7227.FBpp0082562

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]