SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0293022 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0293022
Domain Number 1 Region: 2782-3080
Classification Level Classification E-value
Superfamily BEACH domain 3.27e-107
Family BEACH domain 0.000000154
Further Details:      
 
Domain Number 2 Region: 3155-3226,3301-3376,3425-3519
Classification Level Classification E-value
Superfamily WD40 repeat-like 1.41e-21
Family WD40-repeat 0.0072
Further Details:      
 
Domain Number 3 Region: 2691-2780
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000184
Family GRAM domain 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0293022   Gene: FBgn0262110   Transcript: FBtr0304060
Sequence length 3535
Comment pep:known chromosome:BDGP5:3L:1950306:1964178:-1 gene:FBgn0262110 transcript:FBtr0304060 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGMEVKEKEEQLLLDTLIGLWSQYLQASELEDASVKDHWLWLLLYNLQFLDDKNLQDAW
LNSHFNLMPEELCSYLLEQVYQIISEAKRSQESSPTHEPEQQDKCIKQLRKQHNLAQLIL
STPSDCNKILALRTFLTDKLGHHLLTFLLRVDIKLIASQKSLCHLCINLFPNCKWSASNE
QLIPMTSIAQFIGSFYLNSQSKKLRRQQQPKSQLPNHISNPIKSSFEDFRGTTRSSDELA
LLLIQLLTRCVDAEQESQLSVTVHNFALGHLCSSSEQDASGNNDELIKFELLQLIAHCVN
NFYVLEQQQPNVHDFNSNFGQLLYALTANRRSPLLAHGVLYIMFGTLHNLVDNGVRELNQ
IDVRNFDACFEVLQEAAKSTNFSTAIFLHIYKMLLRLTDNLSSQEQHLQSLMESSASTAM
PKQQQHPRHKRQRSSQLHCLGATSLSCYFQGKLYHLLPSLEAELQEHSVRSLLRTGSCCC
HYNVRNYATCLQLATQLSSSYQKCAYKFLHYNVLHTIFVKRNPQGCPGCEDKLKSPVFHM
DLLNIYKDNYKALLNTPAMLLFLKHLKHIAYLLPYDLASGILAEVALPIFRRYKELIESG
ESKRKISKVTPLQLPSKLENYRALHECLSIFVMYLSDIRLVKAFYNEENIRYMQDLLIIP
ELQRGVCDLIKVGIDNIAFLGENSQEQITLSRRLIQLQLNSSDRASQLFQALLYKCSKHS
RAKFWLDESSTPAKLEGHKPADILYITALQWTLNFELLKTSQLFYNEFAKIYSIPVEMLD
DEDEDEVETPTSELLPGEKKLRHGDKNIFDILKLNYNALGCFLMLPKATMGPTTSSTATT
PTAGICGSSSLETLVSQLPLAGSTSVSVTTAASSDYADSTLDYASVIGNYDSYSRDMATP
SFLQQLLACEPDESTVLFDIRGSQSSKDNPSNSLILPSEEEGATADGIINKLFSIVGSLF
GGSPGSGGSANSPTRANIDADFFCLYEPNGECKKLLLKLFEATMAICIKGFQNEEVEKMQ
KHLRKLRAIILSHATDNWSEHGEQHARDNAVIQTLQTLLKIAELSSTHQEPTGVVNSPSG
DSQQPRPRARSFNSGSVELPRLQTVKLPAKNSLATPPTPRRRPNSSEANAGVDADYFSTR
ASLSCAADSELELSENEHEFYLTADEGYEADGEIADLSESECELNGGVLAANESTWTPFQ
PSSRYRSHIMHQGLSQLVVQMLAELSLLCIKQPNGWTESLTQLANRLFVIRDYLGGPLCL
LKGFAPILSCSDPRLRELQQSILELVTHLNTPEVLQCYYSILASKQPPVDLLMRHMHHIS
SGSLRKAQPCMELDFPIITDGKIVVTSEPLVSEQIERVRLHHQQCQTNTLFTRAACIFPV
TQTRLWQPDGLTLSLWLELRGQQMHRSSMQFNDDETRYSGEDLTKLHLLSLGTNQAMVSI
YISNNMQLIFELVKPNEQLAPVRVEEQIEANADTASVISANTQAANGGTIRQALKQTKLA
LLNSFGQMHLLNGHQASADSTGGYFESSAVQLQHLRLPRHKWMHLVFGLQQQADSVEISI
FLDGLEQHTMRLPFRNLRQLTRVHSFQLLALGEGQPTGRSPGSSSSSRSTLDGSTPRYAL
SNVILFKRRLVDPLLMMNLTAMGPDFTEFTQCQVANWKPNYGFVSLGKLSSSNFGNHLDC
MRQLRQARVLVYTAQQPDLVMSYDASQELDMACYGQPHGHMLYGELQQHQAQTLQAATSL
SGGLSTLLYLFARIVELTGNASTQALALDLLLQVAHSDAQLYTEFQRQDYLSLIGYVIKS
EKCSKDVQLLRSIVNNACSQVLITRKGDSINVNDNTMATLVYPRLMLTVLQRYSDWHRSG
ATHSDVLDMLFRCILALTRDKHPQRDFNMEQLQKCGLLGALLNLCKVYVIESPSPVQISP
YAAECFVQILAVFSGSPPDSSMLDEIMKLLLLLHKPSDCYVTHDRTHFYFLLTAQQPTKE
RSLVAANLSRVTTSLRRQLHPQPQELDPERAERIKKLRRLHASTSGYRKAVNEFEEHLDQ
MADCSNLNKSALRLLSPVEATRWRLKFKRRHPTSANSPKRSPLKIARRRIHPHLHLGKIW
QPSGHSTPSSGQSSLPNRKTDFYDQLGIIRLQQRLLILLKDFLCLLPDSSVDVVTRHYVK
LELLLVLANQRSCAVRQAIIQLVDVLTKRLPSGELNAATKLMHPLHLANQLTIHGCDVGM
FEACLAWINGMHCSLTDIQSCDAPVRIRQRFGLPSLLAIAEGTEPQWVFKALLRLYLQNP
DDQTCLIEAGLLQCSVKALYKIYSLRVGQSNADESVVELLATIGERAMRSVGQINLVWDI
LNLLSFYQDKQPQLIMRSFRTAQAQLQLEWLTKFFEPNSFRVAVTNDSSLSHSELRTRVE
LLIDRCTQFFTVGVGQTTGPNYVASSQELALFQLLVSYGISSNQRCNNFIAWGLQPSRPR
DLRSYIVDALWRSQQDEFQRAIICDAKMIKALLWLSLLEDMPEPIENLKPLCDALGIKEN
DSSWNLVHELDRLDQNRNNMAAKQKTLLEKTVYRFEPLVQQCVESSMVTTRKVAELQNAE
RKALMCHMKVYDDTYTYTKWLEIIRRMTHEGAPWHSAERAECSWELDDTEGPSRVHTRLR
RCHLDIDRRFFMNEYRPGQGHREDLEPYVRPLDYLIASYDQQLNISLNSQILYNFAAKFL
PVDGEIEGEIIITDLKLYFLATYRCRYFNVNCDIANITEIWLKRYQHQETAFEILLDTNK
SLFFSLQNADDWKIMREVFCDKIVATPDQSKVIAITQQWREGLLTNWEYLMTLNQISGRT
YNDLMQYPVFPWVLANYNSEVLDLREGHNFRRLGRPIAVQVEENEKHYISNYTYIDSTNT
TMGSLILKPYHYSSHYSNSGTVLHFLVRVPPFTSYFLRYQDNDFDLPDRTFHALNTTWLL
ASRDSPTDVKELIPEFFCLPEMFENFERFKFGCRQNGERVEDVSLPPWSQRDSRLFVLIH
RQALESELVRNQIHNWIDLIFGYKQSGESAVEAINVFHPATYAVFLDSEISDPIEREAVK
TMVKTYGQMPRQLFKSPHPASKPLDYSLVGKPIVSTVRGLRWGVYVGSPQLKAPSWANIH
KIPGTEHLVSFCNTNVVYALPGRASVMQGAEPDTYNVISWGYDDRIVRIQPLNKPQAKPK
NLLHNGTFDDITACGCDVNSNQLWFGHKSGRISVYKCTGGLDSQQRASAKSRQSYARGFS
LSYNSAFRKMTNKGIGGGGSERVDEAGNLHPTSSASSVNSSSISSGGDAFQRDGADLNWL
GPTLLVRHTDEITCITLSVEFKIAVTAGRDGIAVIWDLNDWSYVRTIARPAEIHQSPITH
VAISPTLGDIVTVHTLPQSCNTSTDPKPTAVATRPNSLNVADECFEVTEENLDDFVNVNV
NPNGKSILRLHSVNARYVQHLVHEDRILAVCYSYIKEGVGVNVIATAVEGGFVRFWSSWN
LSFVSELTTGTSPIRSICYSTHQHLVVLTRESHIQVWESEGLYGNAPKFPQIVYK
Download sequence
Identical sequences Q9W060
FBpp0293022 FBpp0293022 NP_647681.2.81976 FBpp0293022

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]