SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for FBpp0298311 from Drosophila melanogaster 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  FBpp0298311
Domain Number 1 Region: 2008-2309
Classification Level Classification E-value
Superfamily BEACH domain 1.05e-125
Family BEACH domain 0.00000000672
Further Details:      
 
Domain Number 2 Region: 2427-2496,2530-2697
Classification Level Classification E-value
Superfamily WD40 repeat-like 2.34e-33
Family WD40-repeat 0.0044
Further Details:      
 
Domain Number 3 Region: 1910-2006
Classification Level Classification E-value
Superfamily PH domain-like 2.21e-21
Family PreBEACH PH-like domain 0.015
Further Details:      
 
Domain Number 4 Region: 560-704
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000567
Family Laminin G-like module 0.048
Further Details:      
 
Weak hits

Sequence:  FBpp0298311
Domain Number - Region: 141-448,476-543
Classification Level Classification E-value
Superfamily ARM repeat 0.0294
Family Armadillo repeat 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: FBpp0298311   Gene: FBgn0263110   Transcript: FBtr0307310
Sequence length 2712
Comment pep:known chromosome:BDGP5:3L:4193993:4224003:1 gene:FBgn0263110 transcript:FBtr0307310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDNKKDIYNLWVQYTTKNDETHFRQFVARFVAIWRSQLQLDFQAENCPMWHEVQPDSGPH
LGRLPDELLPAIGKFIIVARDVCETEGKLEEQAIEEVAILVDCLVIVCRHFDNILSIIKY
EYKPNLIAILSRVFKQQMELPQSVPAISHLFSSFSAFLEVMYDPYLTWRSFVRGQSADYS
RLSYKPHSVHVEIVPFIYDCFQEEKLIRYAEIGESLLNILGAVICGSQRNGMKAICPATV
SITMSILRQWESANNLRRVALQCYALMVIVLQKSSPEERQIDLVTLVQLYCDALQELLAT
KHFDSGDANFDITSDADQDVAIDMAALSSTVAAVKFFVTGDAGVSEAVSDSNLLELLTNL
PKLIKPWHISHSSSLCSTMEALAILARHSPQSASQLRQGERIERLFTSLQEYGSPTVELL
DTCFMLGYDESEHFLLLPEVMLRLLNWVPTLQEREQLHVTSLVLKGCTDNYRTKTVACGS
HIIKAVCGCLLTAESLAENCVQNLIKLIEELSKLSIVPAELKCIFSLLRQGTKFPQFKQL
QQTLVVIALQSLRGSNSCAEFFSIEQPTDGILVPDIRNWTISGSYGFIFHILVRFNQLKE
QSNSRRMLLTLQTASGSGFEVFVQPNGNVVVAALTRREYLTSSTATKTLMDGQWHYLTVA
ITPPKRPFSYSQINIYVDFVQKLSATLKVQAVNEPFTVCSIGAVVAPPQPGEVAKTGNMP
RSSSQESGSSGYKGMLPSLLERTLSANVSNYFTLPMRTQTAFDPNVKNFPIGMQDTVFGE
QTCLNGHLGGVLLADPTTSLKTIFDAGANFSSIFSQDNDLLELNSRFVFCYAPGAIWHGT
CQDLIPGGKYPGRINAQHCKIVKIQETINSIGGISAILPMLHRLITLDQTTDISIGSVSE
ESLSCAPTPSAEEFTDWEMLSSNSYTEWKMLQHPLASFLCLLRYLTHEHETNQEQLLSSE
CLAIVGTMLQRCPPSLFDVNALMATHLLMESLQGHKAEAGGQLLDALYAHIVFDFAIWSR
LQFQITLGHAQYLSAMIKNDRKFFRKRYGVQFVLDVVRQYYSTPDSISDDDAKTIRATLF
GIIKFYLQKDVNIKEVNSMITFLASVRQDVVLVEFLEMMTFYVRGKNCKDQMVLLLHEPQ
SANLLYNFFVDKSYSNEIQEAAIRFISGLLATSRVHQKYKQVLRLYDQTTEQSMFPGFFS
FITPLSLSSTILFHLVDEMLGLQPDYAGLIFLVYHVSSCDLPVKLEIAKRLLQTTFVKQQ
STVAMAKQTGWQESIARLLIRKPITSSPPDEEKRRSFGINLDVLLEDNSNFLAQADLITF
SEQEIGLAQLQQQQQEELSDSGLILNEIQASVTEAATVIESEIKELAESVSGAVVENANS
LFSVIRQTTHDLQDTFESLTQGSSTDTADGSQTPSIQREESLSSDTSSQSPHGPPKKSDS
LESTSAFDFVADGDVDTEEQLVYLVSNTLFNIFWRGIPNDHPQCWQERGQVLGCINLLAL
NNELITSHLSLRLRILEMAVQASLFDLSEHGSQTLVNQENASHILRMVYELVVLGSNEDE
SKKCSTKLLDGVLALLDALMIFQQGSSDDWSDMIRLCLGLLLKCSHHPNPGIVAMATAKL
HAILQSRSTEDPAELSYLLYSINRALDNAIEVGNPEEYSFLMPVMKALLEKCRVAFNLDS
TLPDLPSTSSGPVFFNDFQMYSTSKKWRNFIERMVKPLYDRYQRDIELHLWEPINRFWAE
CYEACKAASKQRATNQAENRRLFQQKIYMPWKVRQVEEMQRLQAAALQHKTIDSHIRKRW
KTAKRFLYGPRGPWYTGEVDEEFWKLSQHENVARMRLKLEPQLYPNKHENAANLRDNATS
AYDTKEISEFDSTIKNAVVRDFLADDESSQLEEELRQLIDTQAQQDVALEKLVMSQDCEL
ITLMTKVKGRIEVNQSVFTFVDLSPPTEDGSKYDFRFSTNKIREVHLRKYNLRRSALEIF
LVDQTSYFLNFTTKTRNKVFTKIVGLPLPNILYGSGRSPAELLRASGLTQRWINREISNF
EYLMYLNTIAGRSYNDLSQYPVFPWILADYTSDVLDLTDPKSFRDLSKPIGCINPKNEAE
VRGKYDSFEDPSGAIPKFHYGTHYSNSAGVLHYLLRVEPFTSLHIDLQSGRFDVADRQFH
SIPQTWKLLMDNPNDVKELIPEFFYFPEFLKNMNKFDLGHLQITKEKVDDVILPAWATTP
EEFIAIHRRALESEYVSQHLHHWIDLIFGYKQKGPKAAEALNVFYYCSYEGAVDLDKITN
PVEREAVEGMINNFGQVPSQLLREPHPRRLTQDETALKLVRAELRRPDLTQFLDKVVQYY
CELSTPKDPIVYLSPPRSPPRSFLQLSPDVLVSISKSTILGCNSWLSFDKDQGFLLEIDA
TTANLKNRKRIFGPFHSSQQPHSQLFAVSTDGKLLYAGGIWDNSLRVYNLNKGKAVASVT
RHLDIITCIALDNCGSYLVTGSRDCTCIVWSIQTNQQGGGSTNNIPVHALTGQSHLQAIT
QLNTQNSYSPKPLTVLYGHDDAISSVAIYTELDLVVSGSLDGTVNVYTLQEGQFVRTLKP
IGCTESCVQISFVTLSYHGHIAFSALDDTSHSVHVYSINGCSLGSKYVSGRVTGLASASD
YLVVADDAGDITMSRLHGLKPVFDIPLHVPIQTVVVTPGNTHILAPLRDGRLAVIAVQLP
SGGNKKHSVLNV
Download sequence
Identical sequences Q9VZG5
NP_647869.3.81976 FBpp0298311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]